SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33)                   31   0.48 
SB_25197| Best HMM Match : TatC (HMM E-Value=1.8)                      29   3.4  
SB_1961| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.9  
SB_33198| Best HMM Match : 7tm_1 (HMM E-Value=9.80909e-45)             28   5.9  
SB_18056| Best HMM Match : Xan_ur_permease (HMM E-Value=0.96)          28   5.9  
SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1)                     28   5.9  
SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24)              27   7.9  
SB_7225| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   7.9  
SB_11899| Best HMM Match : LRR_1 (HMM E-Value=1.2e-20)                 27   7.9  

>SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33)
          Length = 958

 Score = 31.5 bits (68), Expect = 0.48
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +1

Query: 37  SEVFSFLWASLTSISNDKAPRNILVERGRLELPGP 141
           SE   FLWA+L   +ND+  R +    GR   P P
Sbjct: 459 SECIKFLWAALAQFTNDERSRFLRFVTGRRRPPAP 493


>SB_25197| Best HMM Match : TatC (HMM E-Value=1.8)
          Length = 622

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +1

Query: 304 PSPKLTPYPSFEGNELGNCQTGLTTVY 384
           PSP +T YPS    +LGN  T  + V+
Sbjct: 85  PSPNITSYPSLMTLKLGNFTTATSVVF 111



 Score = 28.7 bits (61), Expect = 3.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +1

Query: 304 PSPKLTPYPSFEGNELGNCQTGLTTVY 384
           PSP +T YPS    ELGN  +  + V+
Sbjct: 274 PSPNITSYPSLMTLELGNFTSATSVVF 300


>SB_1961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 10/37 (27%), Positives = 20/37 (54%)
 Frame = -1

Query: 474 YGAHICNVVVSISAKRLIPKDRSHLVCFDPVYSSQSC 364
           YG  IC+V+  +++ + IP    +    +  Y +Q+C
Sbjct: 41  YGHVICDVIDDVTSSKTIPMSYLYSYLLNETYDNQTC 77


>SB_33198| Best HMM Match : 7tm_1 (HMM E-Value=9.80909e-45)
          Length = 762

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = -3

Query: 352 LIRCLRSSGRALISGMVHMERPVECSSK*LGYLAPPRNADEQFVP 218
           L+RCLR+     +   + + RP   S + LG+L P  + D QFVP
Sbjct: 668 LLRCLRTKK---VEEFMKLMRPF--SFRKLGFLLPVTSVDGQFVP 707


>SB_18056| Best HMM Match : Xan_ur_permease (HMM E-Value=0.96)
          Length = 651

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 304 PSPKLTPYPSFEGNELGNCQTGLTTVY 384
           PSP +T YPS     LGN  T  + V+
Sbjct: 319 PSPNITSYPSLMTLALGNFTTATSVVF 345


>SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1)
          Length = 473

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 304 PSPKLTPYPSFEGNELGNCQTGLTTVY 384
           PSP +  YPS    ELGN  T  + V+
Sbjct: 4   PSPNIKSYPSLMTLELGNFTTATSVVF 30



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 304 PSPKLTPYPSFEGNELGNCQTGLTTVY 384
           PSP +  YPS    ELGN  T  + V+
Sbjct: 382 PSPNIKSYPSLMTLELGNFTTATSVVF 408


>SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24)
          Length = 569

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +3

Query: 309 PEINALPELRRQRIRQLSNRTDYCIQGQSRP 401
           PE++A PE +RQ  RQLS    +  Q    P
Sbjct: 325 PEVDATPEFKRQFSRQLSISRQFSRQDSITP 355


>SB_7225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 249 GARYPSYFELHSTGRSI*TIPEINALPELRR 341
           G R+PS   L  T  SI  + +INAL  LRR
Sbjct: 57  GTRFPSLVGLIFTETSINNLQQINALAMLRR 87


>SB_11899| Best HMM Match : LRR_1 (HMM E-Value=1.2e-20)
          Length = 681

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 249 GARYPSYFELHSTGRSI*TIPEINALPELRR 341
           G R+PS   L  T  SI  + +INAL  LRR
Sbjct: 489 GTRFPSLVGLIFTETSINNLQQINALAMLRR 519


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,281,462
Number of Sequences: 59808
Number of extensions: 391208
Number of successful extensions: 902
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 807
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 901
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1300738331
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).