SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_59684| Best HMM Match : C1_3 (HMM E-Value=8.3)                      40   0.002
SB_28212| Best HMM Match : C1_3 (HMM E-Value=0.59)                     40   0.002
SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24)                   35   0.048
SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16)               35   0.048
SB_22132| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.048
SB_11394| Best HMM Match : GntR (HMM E-Value=7.9)                      35   0.063
SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.083
SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.15 
SB_25665| Best HMM Match : TolA (HMM E-Value=1.7)                      33   0.15 
SB_1652| Best HMM Match : Keratin_B2 (HMM E-Value=0.031)               33   0.15 
SB_54687| Best HMM Match : Trp_Tyr_perm (HMM E-Value=2.2)              33   0.19 
SB_58463| Best HMM Match : DUF1168 (HMM E-Value=0.44)                  33   0.19 
SB_15981| Best HMM Match : Defensin_2 (HMM E-Value=1.1)                32   0.45 
SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092)                     32   0.45 
SB_8486| Best HMM Match : Granulin (HMM E-Value=0)                     31   0.59 
SB_26494| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.78 
SB_41261| Best HMM Match : Metallothio_11 (HMM E-Value=0.74)           31   1.0  
SB_30201| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_18707| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.0  
SB_49425| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09)                   28   1.3  
SB_24975| Best HMM Match : ET (HMM E-Value=1)                          30   1.4  
SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.4  
SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73)                30   1.4  
SB_24840| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23)                   30   1.8  
SB_33149| Best HMM Match : DSL (HMM E-Value=5.60519e-45)               30   1.8  
SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19)                   29   2.4  
SB_16838| Best HMM Match : TolA (HMM E-Value=2)                        29   2.4  
SB_59267| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_31997| Best HMM Match : zf-C2H2 (HMM E-Value=1.4013e-45)            29   3.1  
SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_3598| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11)         29   3.1  
SB_30003| Best HMM Match : DUF906 (HMM E-Value=0)                      29   4.1  
SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1)                 29   4.1  
SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39)          29   4.1  
SB_57157| Best HMM Match : Seryl_tRNA_N (HMM E-Value=1.2)              29   4.1  
SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022)                 28   5.5  
SB_41973| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_15887| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_59233| Best HMM Match : Involucrin (HMM E-Value=2.5)                28   7.2  
SB_57079| Best HMM Match : DUF1140 (HMM E-Value=3.8)                   28   7.2  
SB_53775| Best HMM Match : Involucrin2 (HMM E-Value=7.1e-12)           28   7.2  
SB_38826| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     28   7.2  
SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092)         28   7.2  
SB_14707| Best HMM Match : A_deamin (HMM E-Value=0)                    28   7.2  
SB_7444| Best HMM Match : Transposase_1 (HMM E-Value=9.4)              28   7.2  
SB_7210| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.2  
SB_54394| Best HMM Match : Keratin_B2 (HMM E-Value=1.1)                28   7.2  
SB_44426| Best HMM Match : Lectin_legB (HMM E-Value=4.8)               28   7.2  
SB_32228| Best HMM Match : zf-C4 (HMM E-Value=6.2e-23)                 28   7.2  
SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.2  
SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.2  
SB_41325| Best HMM Match : SWIM (HMM E-Value=0.015)                    27   9.6  
SB_29863| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.6  
SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.6  
SB_16746| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.6  

>SB_59684| Best HMM Match : C1_3 (HMM E-Value=8.3)
          Length = 138

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC-SCCI 430
           C  +CC     + C  CC  RC  +CC    + CC      CC           C +CC+
Sbjct: 14  CRVMCCVACFVMHCVACCVMRC-VACCVMRCVACCVMRCVGCCVMRCVACRVMRCVACCV 72



 Score = 34.3 bits (75), Expect = 0.083
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 4/43 (9%)
 Frame = +2

Query: 266 CCSYSCT----LRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           CC   C     +RC  CC  RC  +CC    + CC  ++ +CC
Sbjct: 54  CCVMRCVACRVMRCVACCVMRC-VACCVMRCVDCC--VVTFCC 93



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 14/43 (32%), Positives = 18/43 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C  + C   C +RC  C   RC  +CC    + CC      CC
Sbjct: 46  CCVMRCVGCCVMRCVACRVMRC-VACCVMRCVACCVMRCVDCC 87



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCF 361
           C  + C   C +RC  CC  RC   CC  +   CC+
Sbjct: 62  CRVMRCVACCVMRCVACCVMRC-VDCCVVT--FCCY 94


>SB_28212| Best HMM Match : C1_3 (HMM E-Value=0.59)
          Length = 218

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/66 (28%), Positives = 26/66 (39%), Gaps = 3/66 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC--- 424
           C  +CC     + C  CC  RC  +CC    + CC      CC       +H    C   
Sbjct: 22  CRVMCCVACFVMHCVACCVMRC-VACCVMRCVACCVMRCVACC------VMHCVACCVMR 74

Query: 425 CICCRL 442
           C+ CR+
Sbjct: 75  CVACRV 80



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC-SCCI 430
           C  +CC     + C  CC  RC  +CC    + CC      CC           C +CC+
Sbjct: 94  CRVMCCVACFVMHCVACCVMRC-VACCVMRCVACCVMRCVGCCVMRCVACRVMRCVACCV 152



 Score = 34.3 bits (75), Expect = 0.083
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 4/43 (9%)
 Frame = +2

Query: 266 CCSYSCT----LRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           CC   C     +RC  CC  RC  +CC    + CC  ++ +CC
Sbjct: 134 CCVMRCVACRVMRCVACCVMRC-VACCVMRCVDCC--VVTFCC 173



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 14/43 (32%), Positives = 18/43 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C  + C   C +RC  C   RC  +CC    + CC      CC
Sbjct: 126 CCVMRCVGCCVMRCVACRVMRC-VACCVMRCVACCVMRCVDCC 167



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCF 361
           C  + C   C +RC  CC  RC   CC  +   CC+
Sbjct: 142 CRVMRCVACCVMRCVACCVMRC-VDCCVVT--FCCY 174



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/61 (26%), Positives = 22/61 (36%), Gaps = 4/61 (6%)
 Frame = +2

Query: 266 CCSYSC----TLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC   C     +RC  CC   C  +CC     + C  + C  C       +     CC+ 
Sbjct: 46  CCVMRCVACCVMRCVACCVMHC-VACCVMR-CVACRVMRCVACR--VMRCVACRVMCCVA 101

Query: 434 C 436
           C
Sbjct: 102 C 102



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 18/67 (26%), Positives = 25/67 (37%), Gaps = 6/67 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSC----CPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           C  + C   C +RC  C   RC  +C    C +  ++CC A     C         + C 
Sbjct: 62  CCVMHCVACCVMRCVACRVMRC-VACRVMRCVACRVMCCVACFVMHCVACCVMRCVACCV 120

Query: 419 -SCCICC 436
             C  CC
Sbjct: 121 MRCVACC 127



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/58 (24%), Positives = 19/58 (32%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C  + C  +C + C   C      +CC    + CC      CC     G     C  C
Sbjct: 86  CRVMRC-VACRVMCCVACFVMHCVACCVMRCVACCVMRCVACCVMRCVGCCVMRCVAC 142


>SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24)
          Length = 2160

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 20/81 (24%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 501  EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPL--AGLEQHQHSMAKQHRMPLLGQQ 328
            +Q   Q+     L+   H+  ++ +QQ+Q    + +    L   Q++  +Q ++    QQ
Sbjct: 1552 QQQQQQLQRQRELQQQQHLQQQRQLQQQQQYIEQKIRQQQLAHQQYTNQQQQQILYQQQQ 1611

Query: 327  EVPHLLEQQKVQRRVQL*EQQ 265
            ++ H  +QQ++Q++ QL +QQ
Sbjct: 1612 QLQHQQQQQQLQQQQQLQQQQ 1632



 Score = 33.5 bits (73), Expect = 0.15
 Identities = 18/60 (30%), Positives = 36/60 (60%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q++QQ+Q + +      +Q Q  + +Q +  L  QQ+    L+QQ++QR+ +L +QQ +
Sbjct: 1495 QQYLQQQQYQQQRQRELQQQQQQQLQQQQQQQL--QQQQQQQLQQQQLQRQRELQQQQQQ 1552



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -1

Query: 444  GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQ-KVQRRVQL*EQ 268
            G  Q +    G   +    L+Q Q+   +Q  +    QQ++    +QQ + Q++ QL +Q
Sbjct: 1479 GPTQSVPTNYGTTYQQQQYLQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQ 1538

Query: 267  QMELHR 250
            Q++  R
Sbjct: 1539 QLQRQR 1544



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 10/85 (11%)
 Frame = -1

Query: 489  VQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAG-LEQHQHSMAKQHRMPLLGQQEVPHL 313
            V  + G   +   ++  +Q+ QQ Q E ++     L+Q Q    +Q +   L QQ++   
Sbjct: 1484 VPTNYGTTYQQQQYLQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQ 1543

Query: 312  LE---------QQKVQRRVQL*EQQ 265
             E         QQ++QR+ +L +QQ
Sbjct: 1544 RELQQQQQQQQQQQLQRQRELQQQQ 1568


>SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16)
          Length = 814

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 20/81 (24%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPL--AGLEQHQHSMAKQHRMPLLGQQ 328
           +Q   Q+     L+   H+  ++ +QQ+Q    + +    L   Q++  +Q ++    QQ
Sbjct: 206 QQQQQQLQRQRELQQQQHLQQQRQLQQQQQYIEQKIRQQQLAHQQYTNQQQQQILYQQQQ 265

Query: 327 EVPHLLEQQKVQRRVQL*EQQ 265
           ++ H  +QQ++Q++ QL +QQ
Sbjct: 266 QLQHQQQQQQLQQQQQLQQQQ 286



 Score = 33.5 bits (73), Expect = 0.15
 Identities = 18/60 (30%), Positives = 36/60 (60%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q++QQ+Q + +      +Q Q  + +Q +  L  QQ+    L+QQ++QR+ +L +QQ +
Sbjct: 149 QQYLQQQQYQQQRQRELQQQQQQQLQQQQQQQL--QQQQQQQLQQQQLQRQRELQQQQQQ 206



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQ-KVQRRVQL*EQ 268
           G  Q +    G   +    L+Q Q+   +Q  +    QQ++    +QQ + Q++ QL +Q
Sbjct: 133 GPTQSVPTNYGTTYQQQQYLQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQ 192

Query: 267 QMELHR 250
           Q++  R
Sbjct: 193 QLQRQR 198



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 10/85 (11%)
 Frame = -1

Query: 489 VQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAG-LEQHQHSMAKQHRMPLLGQQEVPHL 313
           V  + G   +   ++  +Q+ QQ Q E ++     L+Q Q    +Q +   L QQ++   
Sbjct: 138 VPTNYGTTYQQQQYLQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQ 197

Query: 312 LE---------QQKVQRRVQL*EQQ 265
            E         QQ++QR+ +L +QQ
Sbjct: 198 RELQQQQQQQQQQQLQRQRELQQQQ 222


>SB_22132| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 19/60 (31%), Positives = 33/60 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++ L   +Q Q    +Q +   L QQ+    L QQ+ Q++ QL +QQ +
Sbjct: 2   QQQQQQQQQQQQQQLQQQQQQQQLQQQQQQQQQLQQQQQQQQLLQQQQQQQQQLQQQQQQ 61



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 3/87 (3%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMP---LLGQ 331
           +Q L+Q       ++      +Q +QQ+Q +  +P    +Q Q    KQ +     L  Q
Sbjct: 41  QQQLLQQQQQQQQQLQQQQQQQQQLQQQQQQ--QPRLQQQQQQQPRLKQQQQQQPRLKQQ 98

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHR 250
           Q+ P L +QQ+ Q R++  +QQ  L +
Sbjct: 99  QQQPRLKQQQQQQPRLKQQQQQPRLQQ 125



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 1/81 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL-EQQKVQRRVQL*EQQM 262
           +Q  QQ+Q + ++     +Q Q    +Q +  L  QQ+   LL +QQ+ Q+++Q  +QQ 
Sbjct: 3   QQQQQQQQQQQQQLQQQQQQQQLQQQQQQQQQLQQQQQQQQLLQQQQQQQQQLQQQQQQQ 62

Query: 261 ELHRGYGRSEGRCCYQRTQCP 199
           +  +   + + R   Q+ Q P
Sbjct: 63  QQLQQQQQQQPRLQQQQQQQP 83



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSM-AKQHRMPLL--GQQEVPHLLEQQKVQRR 286
           L     +Q + Q+Q + ++ L   +Q Q  +  +Q + P L   QQ+ P L +QQ+ Q R
Sbjct: 35  LQQQQQQQQLLQQQQQQQQQLQQQQQQQQQLQQQQQQQPRLQQQQQQQPRLKQQQQQQPR 94

Query: 285 VQL*EQQMEL 256
           ++  +QQ  L
Sbjct: 95  LKQQQQQPRL 104



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH-LLEQQKVQRRVQ 280
           L     +Q   Q+Q + +  L   +Q Q  + +Q + P L QQ+     L+QQ+ Q R+Q
Sbjct: 65  LQQQQQQQPRLQQQQQQQPRLKQQQQQQPRLKQQQQQPRLKQQQQQQPRLKQQQQQPRLQ 124

Query: 279 L*EQQMEL 256
             +QQ  L
Sbjct: 125 QQQQQPRL 132



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           +Q Q    +Q +  L  QQ+   L +QQ+ Q+++Q  +QQ +L
Sbjct: 2   QQQQQQQQQQQQQQLQQQQQQQQLQQQQQQQQQLQQQQQQQQL 44



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLL---GQQEVPHLLEQQKVQRRVQL*EQ 268
           +Q  Q +Q + ++ L   +Q Q  + +Q +   L    QQ+   L +QQ+ Q+++Q  +Q
Sbjct: 11  QQQQQLQQQQQQQQLQQQQQQQQQLQQQQQQQQLLQQQQQQQQQLQQQQQQQQQLQQQQQ 70

Query: 267 QMELHRGYGRSEGRCCYQRTQCP 199
           Q    +   + + R   Q+ Q P
Sbjct: 71  QQPRLQQQQQQQPRLKQQQQQQP 93



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
           L     +Q +QQ+Q + ++     +Q Q    +Q +   L QQ+      QQ+ Q++ +L
Sbjct: 16  LQQQQQQQQLQQQQQQQQQLQQQQQQQQLLQQQQQQQQQLQQQQQQQQQLQQQQQQQPRL 75

Query: 276 *EQQMELHR 250
            +QQ +  R
Sbjct: 76  QQQQQQQPR 84



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRM-PLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +Q  + +Q + ++P    +Q Q  + +Q +  P L QQ+    L+QQ+ Q R++  +QQ
Sbjct: 80  QQQPRLKQQQQQQPRLKQQQQQPRLKQQQQQQPRLKQQQQQPRLQQQQQQPRLKQQQQQ 138



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLL-GQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           ++Q+Q + R  L   +Q Q  + +Q + P L  QQ+ P L +QQ+ Q R+   +QQ + H
Sbjct: 95  LKQQQQQPR--LKQQQQQQPRLKQQQQQPRLQQQQQQPRLKQQQQQQPRL---KQQQQHH 149


>SB_11394| Best HMM Match : GntR (HMM E-Value=7.9)
          Length = 451

 Score = 34.7 bits (76), Expect = 0.063
 Identities = 27/84 (32%), Positives = 35/84 (41%), Gaps = 17/84 (20%)
 Frame = +2

Query: 254 CNSICCS-----YSCTLRC----TFCCSNRCGT-SC---CPSSGILCCFA-ILCWCCSNP 391
           C   CCS     YSC + C      CCS R    SC   C S  + CC   ++C+ C   
Sbjct: 146 CRVACCSCRVVCYSCRVACCSCRVACCSCRVVCYSCRVVCYSCRVACCSCRVVCYSCRVV 205

Query: 392 ASGSLHSPCSC---CICCRLPIWS 454
                 + CSC   C  CR+  +S
Sbjct: 206 FCSCRVACCSCRVVCYSCRVVCYS 229



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 34/104 (32%), Positives = 44/104 (42%), Gaps = 8/104 (7%)
 Frame = +2

Query: 167 LHTLHKLISPAGH*VL**QHRPSLLP*PLCNSICCS-----YSCTLRCTFCCSNRCGTSC 331
           L   H ++  A H VL   H   L+P   C   CCS     YSC  R  FC    C  +C
Sbjct: 97  LRVAHTVLRIA-HAVLRDAHVVLLMPCCSCRIACCSCRVVCYSC--RVVFCS---CRVAC 150

Query: 332 CPSSGILCCFAILCWCCSNPASGSLHSPCSC---CICCRLPIWS 454
           C  S  + C++    CCS        + CSC   C  CR+  +S
Sbjct: 151 C--SCRVVCYSCRVACCSCRV-----ACCSCRVVCYSCRVVCYS 187



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           +C +Y+  +    CCS  C  +CC S  ++CC   +  C    A   L  P     CC
Sbjct: 363 LCVAYAVVV----CCS--CRVACC-SCRVVCCSCRVVCCSCRVAHAVLRVPHGAVACC 413



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 5/66 (7%)
 Frame = +2

Query: 254 CNSICCS-----YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           C   CCS     YSC + C   CS R     C  +   C   + C  C    S    + C
Sbjct: 230 CRVACCSCRVVCYSCRVAC---CSCRVVCYSCRVACCSCRVHMKCSSCRVVCSSCRVACC 286

Query: 419 SCCICC 436
           SC + C
Sbjct: 287 SCRVVC 292


>SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 367

 Score = 34.3 bits (75), Expect = 0.083
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   + H  Q+Q + ++      QHQH   +Q +     QQ+     +QQ+ Q++    +
Sbjct: 291 HQQHQLHQHQQQHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQQ 350

Query: 270 QQMELHR 250
           QQ + H+
Sbjct: 351 QQQQQHQ 357



 Score = 31.5 bits (68), Expect = 0.59
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQ-HQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           ++Q  QQ+Q + +  L    Q HQH    Q++     Q +  H  +QQ+ Q++ Q  +QQ
Sbjct: 275 TQQQQQQQQQQQQHQLHQQHQLHQHQQQHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQQQ 334

Query: 264 ME 259
            +
Sbjct: 335 QQ 336



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 21/92 (22%), Positives = 38/92 (41%)
 Frame = -1

Query: 480 HTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQ 301
           +  N   +      +Q  QQ+Q         L QHQ     QH+     Q +  H  +QQ
Sbjct: 265 NNNNTTAITTTQQQQQQQQQQQQHQLHQQHQLHQHQQ----QHQYQQQHQHQHQHQHQQQ 320

Query: 300 KVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQ 205
           + Q++ Q  +QQ +  +   + + +   Q+ Q
Sbjct: 321 QQQQQQQQQQQQQQQQQQQQQQQQQQLQQQQQ 352


>SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2870

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 24/69 (34%), Positives = 27/69 (39%), Gaps = 3/69 (4%)
 Frame = +2

Query: 305  CSNRCGTSCCPSSGILCCFAILCWC---CSNPASGSLHSPCSCCICCRLPIWSSTSSTFP 475
            C   C  SC P   I CC   L  C   CS    G+   P  CC+       SST+S   
Sbjct: 1346 CPAVCSESCKPDCPIKCCSNALSSCPQSCSGDHCGA-ECPTQCCLLADNGQHSSTAS--- 1401

Query: 476  VWICTSVCS 502
               C S CS
Sbjct: 1402 ---CPSACS 1407



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 27/89 (30%), Positives = 32/89 (35%), Gaps = 6/89 (6%)
 Frame = +2

Query: 251  LCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSN-PASGSLHSPC 418
            +C   C   C  SC L+    C   C   C P     CCFA+L     N   S S    C
Sbjct: 1232 VCKETCKPECPLSCCLKDARGCPATCVEDCKPGCPPECCFAVLKPIQENREHSQSCPKIC 1291

Query: 419  --SCCICCRLPIWSSTSSTFPVWICTSVC 499
              SC   C +   S  S+  P    T  C
Sbjct: 1292 FTSCKPSCPVHCCSEHSNACPQECSTDNC 1320



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 32/93 (34%), Positives = 37/93 (39%), Gaps = 9/93 (9%)
 Frame = +2

Query: 248  PLCNSICCSYSCTLRC----TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
            P C   CC  S         T  C   C  +C P   + CC  ++    SN A  + HS 
Sbjct: 2191 PYCPVKCCESSTAPSTKEYSTDECPEICSHNCLPFCPVKCCAVVV---PSNQAEAT-HSS 2246

Query: 416  C-SCCICCRLPIWSS---TSSTF-PVWICTSVC 499
            C S C    LP   S   TSST  PV   TS C
Sbjct: 2247 CPSVCSTTCLPFCPSKCCTSSTVTPVQPTTSSC 2279



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 5/65 (7%)
 Frame = +2

Query: 260  SICCSYSCTLRCTF-CCSNRCG----TSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
            SI C  SC   C   CC N C     +SC P     CCF +L     N  S     P  C
Sbjct: 1175 SIMCKRSCEEGCPEQCCQNGCPVECLSSCKPHCPPRCCFTVLIPIADN-QSVKEKCPAVC 1233

Query: 425  CICCR 439
               C+
Sbjct: 1234 KETCK 1238



 Score = 31.5 bits (68), Expect = 0.59
 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 3/59 (5%)
 Frame = +2

Query: 269  CSYSCTLRCTF-CCSNRCGTSCCPS--SGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
            CS SC   C   CCSN    S CP   SG  C       CC    +G   S  SC   C
Sbjct: 1350 CSESCKPDCPIKCCSN--ALSSCPQSCSGDHCGAECPTQCCLLADNGQHSSTASCPSAC 1406



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 6/63 (9%)
 Frame = +2

Query: 269  CSYSCTLRCTF-CCSNRCGTSCCPSS-----GILCCFAILCWCCSNPASGSLHSPCSCCI 430
            CS +C   C   CC+  C   C PS+        CC  IL      P + + + P  C  
Sbjct: 1441 CSETCKPECPVKCCTGECPAGCLPSNCKPDCPSKCCLTILEPLQEGP-NATAYCPSDCFE 1499

Query: 431  CCR 439
             C+
Sbjct: 1500 SCK 1502



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 26/98 (26%), Positives = 35/98 (35%), Gaps = 13/98 (13%)
 Frame = +2

Query: 251  LCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPA----SGSLH 409
            LC   C   C   C ++C    S+ C   C P +    C +I C      A      S  
Sbjct: 1552 LCPVYCLTSCKPDCPIKCCTKLSSSCPADCSPQNCKSSCPSICCITIRGSAKEEQQNSFE 1611

Query: 410  SPCSCCICC--RLPI-WSSTSSTFPVWI---CTSVCSI 505
             P  C   C    P+   S S T  + +   C S CS+
Sbjct: 1612 CPVKCLTSCEPECPVRCCSGSQTLDLGVSKTCPSWCSV 1649



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = +2

Query: 248  PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC 358
            P C S CC  +        C   C T+C P   ++CC
Sbjct: 1783 PSCPSTCCIKNSP---PVVCPKSCETTCTPDCPVMCC 1816



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 9/27 (33%), Positives = 10/27 (37%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFCCSNRCGTSCC 334
            C   CC   C + C   C   C   CC
Sbjct: 1186 CPEQCCQNGCPVECLSSCKPHCPPRCC 1212



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 5/76 (6%)
 Frame = +2

Query: 296  TFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSCCICCRLPI---WSST 460
            T  C + C  SC P+  I CC   AI C    +  S     P  CC+    P     ++ 
Sbjct: 1490 TAYCPSDCFESCKPNCPIKCCPATAIKCPVGCSEHSCKPECPSKCCMKVLPPTTLGQNTA 1549

Query: 461  SSTFPVWICTSVCSID 508
            +S  PV+ C + C  D
Sbjct: 1550 NSLCPVY-CLTSCKPD 1564



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 22/90 (24%), Positives = 32/90 (35%), Gaps = 5/90 (5%)
 Frame = +2

Query: 248  PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILC-----CFAILCWCCSNPASGSLHS 412
            P C   CCS + +     C  + CG  C     +L           C    +P+  +   
Sbjct: 1356 PDCPIKCCSNALSSCPQSCSGDHCGAECPTQCCLLADNGQHSSTASCPSACSPSGCNPDC 1415

Query: 413  PCSCCICCRLPIWSSTSSTFPVWICTSVCS 502
            P  CCI    P+    ++T     C S CS
Sbjct: 1416 PARCCITVLQPLNEKHNTTAE---CPSECS 1442



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 1/59 (1%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFCCSNRCG-TSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
            C   C +  CT      C   C   SC P   ++CC ++    CS  + G+   P  CC
Sbjct: 1652 CKPDCPARCCTTEPLSACPATCSPDSCRPECPLICC-SVCPPNCSAQSCGNF-CPPKCC 1708



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/55 (23%), Positives = 22/55 (40%)
 Frame = +2

Query: 305  CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPIWSSTSST 469
            C + C  +C P   + CC    C     P++     P  CC+    P+    ++T
Sbjct: 1437 CPSECSETCKPECPVKCCTG-ECPAGCLPSNCKPDCPSKCCLTILEPLQEGPNAT 1490



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 21/70 (30%), Positives = 26/70 (37%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254  CNSIC---CSYSCTLRC----TFCCSNRCGT-SCCPSSGILCCFAILCWCCSNPASGSLH 409
            C  IC   C  SC + C    +  C   C T +C PS    CC  +L     N  S    
Sbjct: 1287 CPKICFTSCKPSCPVHCCSEHSNACPQECSTDNCKPSCPSECCLTVLTPLKEN-KSHQEG 1345

Query: 410  SPCSCCICCR 439
             P  C   C+
Sbjct: 1346 CPAVCSESCK 1355



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 22/84 (26%), Positives = 33/84 (39%)
 Frame = +2

Query: 248  PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
            P C +I  S + +L     C   C T C PS    CC           +  +  +P    
Sbjct: 1754 PGCITIEDSVTVSLGNDKLCPEACLTKCLPSCPSTCCIKNSPPVVCPKSCETTCTPDCPV 1813

Query: 428  ICCRLPIWSSTSSTFPVWICTSVC 499
            +CC+    +S+ +T    IC S C
Sbjct: 1814 MCCK----NSSPATECPTICASKC 1833


>SB_25665| Best HMM Match : TolA (HMM E-Value=1.7)
          Length = 697

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H+   +  QQ++ +  +   G +Q Q     Q R  L  +Q+  HL +QQ+ Q++ Q  +
Sbjct: 231 HLQQHRQQQQQRLDRHQQQQGQQQQQQQQRLQQRRQLRERQQ-RHLQQQQQRQQQFQRQQ 289

Query: 270 QQMELHR 250
           QQ ++ +
Sbjct: 290 QQQQMQQ 296



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/65 (23%), Positives = 32/65 (49%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           G +Q  QQ++ + R  L   +Q      +Q +     QQ+   + ++Q++Q+  Q  + Q
Sbjct: 251 GQQQQQQQQRLQQRRQLRERQQRHLQQQQQRQQQFQRQQQQQQMQQRQQLQQLQQQQQPQ 310

Query: 264 MELHR 250
            + H+
Sbjct: 311 QQHHQ 315


>SB_1652| Best HMM Match : Keratin_B2 (HMM E-Value=0.031)
          Length = 563

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 25/86 (29%), Positives = 36/86 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P C  +CC+ SC  R   C +     SCC     + C A+LC   S  A       C   
Sbjct: 355 PCCVVLCCAVSC--RAVLCRA----VSCC----AVLCRAVLCRAVSCRAVLCRAVLC-LA 403

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCSI 505
           + CR+ +  + S    VW C  +C +
Sbjct: 404 VLCRVVLCRAVSCC-TVWCCVVLCRV 428



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 21/77 (27%), Positives = 29/77 (37%), Gaps = 6/77 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSG---ILCCFAILC--WCCSNPASGSLHSP 415
           L + + C     LR   CC   C    C +     +LCC    C   CC+      L   
Sbjct: 314 LSSQLLCFTVLALRVVTCCVVLCCAVLCRAVSCRVVLCCVVPCCVVLCCAVSCRAVLCRA 373

Query: 416 CSCC-ICCRLPIWSSTS 463
            SCC + CR  +  + S
Sbjct: 374 VSCCAVLCRAVLCRAVS 390


>SB_54687| Best HMM Match : Trp_Tyr_perm (HMM E-Value=2.2)
          Length = 369

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 2/39 (5%)
 Frame = +2

Query: 293 CTFCCSNRC--GTSCCPSSGILCCFAILCWCCSNPASGS 403
           C F C  +C  GT  C    ++ C   LC C  NP S +
Sbjct: 2   CIFNCIGKCIGGTCKCVGKSLMACLRGLCKCFCNPVSAA 40


>SB_58463| Best HMM Match : DUF1168 (HMM E-Value=0.44)
          Length = 603

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV--PHLLEQQKVQRRVQL*EQQ 265
           +Q  QQE    ++    ++Q Q    +Q R   L QQ++   HL  QQ+ QRR Q  +QQ
Sbjct: 263 KQQQQQEMKIQQQQQQYIQQQQVQHMQQQR---LQQQQLLQQHLQRQQQQQRRHQQQQQQ 319

Query: 264 MELHR 250
            +LH+
Sbjct: 320 QQLHQ 324



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 5/72 (6%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH-----LLEQQKVQRR 286
           H    QH  Q Q +        +Q Q    +Q +   + QQ+V H     L +QQ +Q+ 
Sbjct: 243 HQRPSQHKTQTQNKQSRASKKQQQQQEMKIQQQQQQYIQQQQVQHMQQQRLQQQQLLQQH 302

Query: 285 VQL*EQQMELHR 250
           +Q  +QQ   H+
Sbjct: 303 LQRQQQQQRRHQ 314


>SB_15981| Best HMM Match : Defensin_2 (HMM E-Value=1.1)
          Length = 890

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +2

Query: 251 LCNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGILCCFAILCWCCS 385
           L  S CC  +CT  +C   CS+R  T    ++ I  C ++L  C S
Sbjct: 562 LLTSACCCKTCTRPKCAIHCSSRRQTKTSGNTKICACPSLLLACTS 607


>SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092)
          Length = 1146

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGL--EQHQHSMA-KQHRMPLLGQQEVPHLLEQQKVQ--RRV 283
           + S+Q  QQ Q +    L     E+ Q  MA KQH+  LL  Q+   L  QQ++Q  +R+
Sbjct: 647 ISSQQPQQQPQQQQLNQLQQQHREKLQQQMAEKQHQESLLLLQKQQQLQHQQRIQQQQRL 706

Query: 282 QL*EQQMELHR 250
           Q  +Q+++LH+
Sbjct: 707 QQQQQRIQLHQ 717



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 20/87 (22%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECR---EPLAGLEQHQHSMAKQHRMPLLGQ 331
           +++L+ +     L+    +  +Q +QQ+Q   +   E L   +Q      KQ +   L +
Sbjct: 682 QESLLLLQKQQQLQHQQRIQQQQRLQQQQQRIQLHQEQLKQQQQLHQEQLKQQQQQQLHR 741

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHR 250
           +++    +QQ  Q +++  +QQ +LHR
Sbjct: 742 EQLKQKQQQQLHQEQLKQ-QQQQQLHR 767


>SB_8486| Best HMM Match : Granulin (HMM E-Value=0)
          Length = 878

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = +2

Query: 296 TFCCSNRC-GTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPI 448
           T CC  R  G +CCP    +CC +    CC N  S  L S        R+PI
Sbjct: 562 TTCCKKRSGGYACCPIPKAVCC-SDEVHCCPNGYSCDLSSKKCVKGASRVPI 612


>SB_26494| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 237

 Score = 31.1 bits (67), Expect = 0.78
 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = -1

Query: 540 SLCRKALCSFSSIEQTLVQIH-TGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSM 364
           SL  + +   ++ E+ + +   TG  L +      +Q  QQ+Q + ++     +Q Q   
Sbjct: 144 SLYHEQIIFLATFEKRINEFSFTGGSLGLYKQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 203

Query: 363 AKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
            +Q +     QQ+     +QQ+ Q++ Q  +QQ
Sbjct: 204 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 236



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 174 KQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 233



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 175 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 234



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 176 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 235



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 177 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 236



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 178 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 237



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/63 (23%), Positives = 31/63 (49%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +G  +  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +Q
Sbjct: 170 LGLYKQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 229

Query: 267 QME 259
           Q +
Sbjct: 230 QQQ 232


>SB_41261| Best HMM Match : Metallothio_11 (HMM E-Value=0.74)
          Length = 328

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 6/48 (12%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSC-----CPSSGILCC-FAILCWCCS 385
           ++CC  +C  RC+ C    C  +C     C     LCC F  LC  CS
Sbjct: 223 NLCCCVTC--RCSVCTCCPCDCTCLQCAPCIVFSALCCPFWSLCLLCS 268



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
 Frame = +2

Query: 356 CFAILCWCCSNPASGSLHSPCSC-CICCRLPIWSSTSSTFPVWICTSVCSI 505
           C+  LC C +   S     PC C C+ C  P    ++   P W    +CS+
Sbjct: 220 CYVNLCCCVTCRCSVCTCCPCDCTCLQC-APCIVFSALCCPFWSLCLLCSM 269


>SB_30201| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 537 LCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREP-LAGLEQHQHSMA 361
           L  K L     ++Q  +Q+   N   +   +  +Q  QQ+Q + ++P    L+Q Q    
Sbjct: 40  LREKELNMKKEMQQQQLQLQQKNTEMMQAMVQQQQQQQQQQPQQQQPQQQQLQQQQLQQQ 99

Query: 360 KQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +  +  L  QQ+    L+QQ+ Q++ Q  +Q  +
Sbjct: 100 QLQQQQLQQQQQQQQQLQQQQPQQQQQQQQQPQQ 133



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/59 (33%), Positives = 35/59 (59%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q  QQ+Q + ++P    +Q Q    +Q +   L QQ+    L+QQ++Q++ QL +QQM
Sbjct: 108 QQQQQQQQLQQQQPQQQQQQQQQPQQQQPQQQQLQQQQ----LQQQQLQQQ-QLQQQQM 161



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/60 (30%), Positives = 35/60 (58%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ+Q + ++    L+Q Q    +Q +     QQ     L+QQ++Q++ QL +QQ++
Sbjct: 103 QQQLQQQQQQQQQ----LQQQQPQQQQQQQQQPQQQQPQQQQLQQQQLQQQ-QLQQQQLQ 157


>SB_18707| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 176

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 537 LCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREP-LAGLEQHQHSMA 361
           L  K L     ++Q  +Q+   N   +   +  +Q  QQ+Q + ++P    L+Q Q    
Sbjct: 39  LREKELNMKKEMQQQQLQLQQKNTEMMQAMVQQQQQQQQQQPQQQQPQQQQLQQQQLQQQ 98

Query: 360 KQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +  +  L  QQ+    L+QQ+ Q++ Q  +Q  +
Sbjct: 99  QLQQQQLQQQQQQQQQLQQQQPQQQQQQQQQPQQ 132



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/59 (33%), Positives = 35/59 (59%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q  QQ+Q + ++P    +Q Q    +Q +   L QQ+    L+QQ++Q++ QL +QQM
Sbjct: 107 QQQQQQQQLQQQQPQQQQQQQQQPQQQQPQQQQLQQQQ----LQQQQLQQQ-QLQQQQM 160



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/60 (30%), Positives = 35/60 (58%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ+Q + ++    L+Q Q    +Q +     QQ     L+QQ++Q++ QL +QQ++
Sbjct: 102 QQQLQQQQQQQQQ----LQQQQPQQQQQQQQQPQQQQPQQQQLQQQQLQQQ-QLQQQQLQ 156


>SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 778

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/78 (24%), Positives = 37/78 (47%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q     Q +     +QE     +QQ+ Q++ Q  +QQ +
Sbjct: 18  QQQQQQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQQQQQQQQQQQQ 77

Query: 258 LHRGYGRSEGRCCYQRTQ 205
            H+   + E +   Q+ Q
Sbjct: 78  QHQQQQQQEQQQQQQQQQ 95



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           V+    ++Q  QQ+Q + ++     +Q Q     Q +     QQE     +QQ+ Q++ Q
Sbjct: 9   VIARGSTKQQQQQQQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQQQ 68

Query: 279 L*EQQME 259
             +QQ +
Sbjct: 69  QQQQQQQ 75



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+Q E  +     +Q Q    +Q +      Q+     +QQ+ Q++ Q  +QQ + 
Sbjct: 45  QQQQQQQQEQEQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQEQQQQQQQQQQQQQQQQQP 104

Query: 255 HR 250
           H+
Sbjct: 105 HQ 106



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/60 (25%), Positives = 30/60 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  Q +Q + ++     +Q Q    +Q +     QQ+  H  +QQ+ Q++ Q  +QQ +
Sbjct: 39  QQQPQPQQQQQQQQEQEQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQEQQQQQQQQQQQQ 98



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/58 (24%), Positives = 30/58 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +Q  +Q+Q + ++     +Q Q    +QH+     +Q+     +QQ+ Q++ Q  +QQ
Sbjct: 51  QQEQEQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQEQQQQQQQQQQQQQQQQQPHQQQ 108



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 20/97 (20%), Positives = 42/97 (43%)
 Frame = -1

Query: 489 VQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL 310
           V I  G+  +       +Q  QQ+Q + ++     +  Q    +Q +     QQ+     
Sbjct: 8   VVIARGSTKQQQQQQQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQQ 67

Query: 309 EQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCP 199
           +QQ+ Q++ Q  +QQ +  +   + + +   Q+ Q P
Sbjct: 68  QQQQQQQQQQQHQQQQQQEQQQQQQQQQQQQQQQQQP 104


>SB_49425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 429

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC-SCC 427
           +C S+C      + CT C S R   S C S    C   ++C  C   A   +HS C S C
Sbjct: 276 VCVSLCAQCMRVVMCTVCAS-RYVHSVCVSLCTQCMRVVMCTVC---ACRYIHSVCVSLC 331



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCS 385
           +C S+C      + CT C   R G S C S    C   ++C  C+
Sbjct: 384 VCVSLCAQCVRVVMCTVCAC-RLGHSVCVSLCAQCVRVVMCTVCA 427



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 15/91 (16%)
 Frame = +2

Query: 275 YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCS----NPASGSLHSPCS------- 421
           ++  LRCT C   R   S C S    C   ++C  C+    +    SL S C        
Sbjct: 218 FTVRLRCTVCAC-RYVHSVCVSFRSQCVRVVMCTVCACRYVHSVCVSLRSQCVRVIMYTV 276

Query: 422 ----CCICCRLPIWSSTSSTFPVWICTSVCS 502
               C  C R+ + +  +S +   +C S+C+
Sbjct: 277 CVSLCAQCMRVVMCTVCASRYVHSVCVSLCT 307


>SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09)
          Length = 1103

 Score = 28.3 bits (60), Expect(2) = 1.3
 Identities = 9/27 (33%), Positives = 13/27 (48%)
 Frame = +2

Query: 272 SYSCTLRCTFCCSNRCGTSCCPSSGIL 352
           +Y C   C F C   C  +CC   G++
Sbjct: 753 AYVCKEECKFSCDLDCPENCCGPEGLM 779



 Score = 20.6 bits (41), Expect(2) = 1.3
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +2

Query: 248 PLCNSICCSY 277
           P C+ ICC +
Sbjct: 714 PACSDICCGF 723


>SB_24975| Best HMM Match : ET (HMM E-Value=1)
          Length = 316

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFC-CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +C+S C S +     T C C ++C  S    + I  C      C S   S + H+P + C
Sbjct: 207 ICDSQCISDTQHTPVTQCICDSQC-ISDTQHTPITQCI-----CDSQCISDTQHTPVTQC 260

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCSIDEKEH 520
           IC    I  +  +     IC S C I + +H
Sbjct: 261 ICDSQYISDTQHTPITQCICDSQC-ISDTQH 290



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +2

Query: 371 CWCCSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQ 535
           C C S   S + H+P + CIC    I  +  +     IC S C I + +H    Q
Sbjct: 188 CICDSQYISDTQHTPVTQCICDSQCISDTQHTPVTQCICDSQC-ISDTQHTPITQ 241



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +2

Query: 371 CWCCSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQ 535
           C C S   S + H+P + CIC    I  +  +     IC S C I + +H    Q
Sbjct: 206 CICDSQCISDTQHTPVTQCICDSQCISDTQHTPITQCICDSQC-ISDTQHTPVTQ 259



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +2

Query: 371 CWCCSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQ 535
           C C S   S + H+P + CIC    I  +  +     IC S C I + +H    Q
Sbjct: 170 CICDSQCISDTQHTPVTQCICDSQYISDTQHTPVTQCICDSQC-ISDTQHTPVTQ 223


>SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1268

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/63 (23%), Positives = 33/63 (52%)
 Frame = -1

Query: 393  AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQ 214
            A L+Q Q    +Q   P + QQ+  H +++Q++Q++    +QQ +  +   + + +   Q
Sbjct: 1101 AQLQQQQLQKPQQQSQPQIAQQQQLHEMQRQQIQQQQMQQQQQQQQQQQIQQQQQQMQQQ 1160

Query: 213  RTQ 205
            + Q
Sbjct: 1161 QLQ 1163



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/60 (26%), Positives = 31/60 (51%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q +Q+ Q +  +P    +Q  H M +Q       QQ+     +QQ  Q++ Q+ +QQ++
Sbjct: 1105 QQQLQKPQQQS-QPQIAQQQQLHEMQRQQIQQQQMQQQQQQQQQQQIQQQQQQMQQQQLQ 1163


>SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73)
          Length = 617

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +2

Query: 392 ASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHK 523
           AS ++   CS C  C  P+ SS   T    +CTS  +    +HK
Sbjct: 49  ASYAISDCCSACPDCARPVRSSDLDTHKSHMCTSKATSTSVQHK 92


>SB_24840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 328

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 4/46 (8%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGT-SCCPS---SGILCCFAILCWCCS 385
           ++CC  +C      CC   C    C P    S + C F  LC  CS
Sbjct: 223 NLCCCVTCRCSVCTCCPCDCPCLQCAPCIVFSALCCPFWSLCLLCS 268



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
 Frame = +2

Query: 356 CFAILCWCCSNPASGSLHSPCSC-CICCRLPIWSSTSSTFPVWICTSVCSI 505
           C+  LC C +   S     PC C C+ C  P    ++   P W    +CS+
Sbjct: 220 CYVNLCCCVTCRCSVCTCCPCDCPCLQC-APCIVFSALCCPFWSLCLLCSM 269


>SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23)
          Length = 1189

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 1/38 (2%)
 Frame = +2

Query: 275  YSCTLRCTFCCSNRCGTSCCPSSGILC-CFAILCWCCS 385
            YSC   C F C  +C   CC ++     C +   W C+
Sbjct: 932  YSCPSDCHFSCYPQCTPECCSTTPPTAQCPSSCAWTCA 969



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/37 (35%), Positives = 15/37 (40%)
 Frame = +2

Query: 248  PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC 358
            P C   CCS   T   T  C + C  +C P     CC
Sbjct: 944  PQCTPECCS---TTPPTAQCPSSCAWTCAPDCTSECC 977


>SB_33149| Best HMM Match : DSL (HMM E-Value=5.60519e-45)
          Length = 443

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 9/31 (29%), Positives = 19/31 (61%)
 Frame = -2

Query: 347 CRYWGSKRCRTYWSSKRCSVGCSYRSSKWSC 255
           C   G+++C+ +W  ++C V C  R  +++C
Sbjct: 234 CLANGTRKCQQHWYGQQCHVFCQPRPIQYTC 264


>SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2988

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -2

Query: 353  IGCRYWGSKRCRTYWSSKRCSVGCSYRSSKWSC 255
            +GC YW     +  WS++ C VG +  SS+  C
Sbjct: 1786 VGCMYWDE--VQENWSTRGCRVGPNTSSSRTHC 1816


>SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19)
          Length = 3083

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -2

Query: 356  SIGCRYWGSKRCRTYWSSKRCSVG 285
            S+GCRYW S    T W++K C VG
Sbjct: 2195 SVGCRYW-SLASNT-WTTKGCKVG 2216


>SB_16838| Best HMM Match : TolA (HMM E-Value=2)
          Length = 371

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 21/78 (26%), Positives = 35/78 (44%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ++ + ++    L+Q Q    +Q R P   +Q+      QQK Q++ Q  + Q  
Sbjct: 64  QQKRQQQKQKRQQQEQKLQQQQRRQQQQKRQPQQRRQQQQQRQPQQKSQQQQQQQQPQQP 123

Query: 258 LHRGYGRSEGRCCYQRTQ 205
            H G      R  +Q  Q
Sbjct: 124 SH-GQQEPHQRRLFQNGQ 140


>SB_59267| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1444

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE--VPHLLEQQKVQRRVQ 280
           G    +Q+E  E ++ +  ++Q QH   ++ +  LL QQE     + + +  QR VQ
Sbjct: 368 GDEVRLQREMLEQQQKIIKMQQQQHQQHEEQQQRLLKQQEGLCEQIRQLENHQREVQ 424


>SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 334

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 19/84 (22%), Positives = 28/84 (33%), Gaps = 4/84 (4%)
 Frame = +2

Query: 266 CCSYSCTLR--CTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCR 439
           CC     +R  C  C S       CP    + C  + C CC +     +  PC   +C  
Sbjct: 103 CCMSLLRVRVACPCCVSVLRVLIACPCWVSVLCVRVACPCCVSVLRVRVGCPCWVYVCTG 162

Query: 440 LPIWSSTSSTFPVW--ICTSVCSI 505
                      P W  +CT   ++
Sbjct: 163 CVSVLRVRVVCPCWVYVCTGCVAV 186


>SB_31997| Best HMM Match : zf-C2H2 (HMM E-Value=1.4013e-45)
          Length = 1091

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQ 328
           +  L H G ++H   + G+C      L++H   H+  K+H  P  G++
Sbjct: 153 MHALTHTGEKEHQCLQCGKCFALAGTLKRHALIHTEEKEHHCPQCGKR 200


>SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1067

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           G +Q  QQ+Q E  +      Q Q   ++Q+R P   QQ+ P   EQQ+   ++Q
Sbjct: 515 GQQQQQQQQQQENNQQYNQGNQQQQQDSQQNRQPGGQQQQQP---EQQQTNSQLQ 566



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 3/63 (4%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLL---GQQEVPHLLEQQKVQRRVQL*EQ 268
           +Q  QQ+  +  +P    +Q Q +  +Q + P     GQQE   L +QQ +Q+  Q   Q
Sbjct: 685 QQQQQQQDQQHYQPSQEQQQQQQNDNQQQKSPPTSPPGQQEQQPLSQQQDIQQERQNSLQ 744

Query: 267 QME 259
           Q +
Sbjct: 745 QTD 747


>SB_3598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 437 RLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTKDLLVDKSL 574
           RL + S+ SST P+    S  ++    HK F Q ++TK++L  KS+
Sbjct: 7   RLIVKSNHSSTIPI---LSDVNVRSAGHKVFHQAVRTKEVLFAKSV 49


>SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11)
          Length = 1461

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%)
 Frame = -1

Query: 258  LHRGYGRSEGRCCYQRTQ-CPAGDINLCSVWRNVLRYSLSVSHVGWSNQRSSGYCW 94
            +HR  G +      QRT  C  G+++   +    L+ SLSV+ + W    S    W
Sbjct: 1179 VHRTPGEARSHLLRQRTNVCGGGEVDQAGMQDERLQDSLSVNQIRWQFNLSRAPWW 1234


>SB_30003| Best HMM Match : DUF906 (HMM E-Value=0)
          Length = 2276

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = -1

Query: 399 PLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           P A   Q Q SM+ Q + P   Q      L+QQ+ Q++  L +QQ +
Sbjct: 661 PTASAPQLQSSMSSQQQQPQQHQISAQQQLQQQQHQQQQLLQQQQQQ 707


>SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1146

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = -1

Query: 453  DHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
            DH    QH QQ+Q   ++     +Q QH   +QH      QQ+     +QQ+  ++ Q  
Sbjct: 1072 DHEQPAQHDQQQQNTGQQQQHD-KQQQHDQQQQH-----DQQQQHDQQQQQRHDQQQQHH 1125

Query: 273  EQQMELH 253
            +QQ + H
Sbjct: 1126 DQQQQQH 1132


>SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1)
          Length = 530

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/34 (35%), Positives = 15/34 (44%)
 Frame = +2

Query: 275 YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW 376
           +S  L C   C + C  SC P+    CC    CW
Sbjct: 437 FSVPLTCPVGCPSMCAPSCTPA----CCAEQQCW 466


>SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39)
          Length = 407

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = -2

Query: 455 WTIWVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWS 306
           WT W   +  +R+R S GS  +   ST +VW + +   Y   K    YW+
Sbjct: 194 WTEWGQDARITRARLSDGSGKEVLVSTGLVWPNGLAMDYVDKK---IYWA 240


>SB_57157| Best HMM Match : Seryl_tRNA_N (HMM E-Value=1.2)
          Length = 334

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE--VPHLLEQQ--K 298
           LE+L H   R   Q +Q + +       +H+   +K+  M LL ++     HL+E+Q  +
Sbjct: 17  LEILQHEQERLKTQNKQLQLKLRDGSRVKHELQQSKETGMKLLSERNKLFEHLVERQSKR 76

Query: 297 VQRRVQL*EQQMELHRGYGRS 235
           V  + Q  +Q+   +R  G++
Sbjct: 77  VNTQHQDDQQEQTSYRDIGKA 97


>SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022)
          Length = 1421

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 16/60 (26%), Positives = 30/60 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ+ L
Sbjct: 129 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLLL 188



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           N+L        +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q
Sbjct: 124 NILAPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 183

Query: 291 RRVQL 277
           +++ L
Sbjct: 184 QQLLL 188


>SB_41973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2504

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = -1

Query: 459  VLDHMGSRQHMQQEQGECREPLAGLEQH--QHSMAKQHRMPLLGQ 331
            VL H G + H   + G+C      L+ H   H+  K+H+ P  G+
Sbjct: 2348 VLTHTGEKGHQCLQCGKCFAQARHLKTHALTHTRKKEHQCPQCGK 2392


>SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1276

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 20/70 (28%), Positives = 27/70 (38%), Gaps = 4/70 (5%)
 Frame = +2

Query: 302  CCSNRCGTSCCPSSGILC----CFAILCWCCSNPASGSLHSPCSCCICCRLPIWSSTSST 469
            CC   C     P   +LC    C+ +LC      A  SL  PC   +C  +P +   S  
Sbjct: 1076 CCPLLC--RAIPCYDLLCLAMTCYDLLCLAVPCYALLSLAMPCCPLLCLAVPCYVVLSLA 1133

Query: 470  FPVWICTSVC 499
             P   C  +C
Sbjct: 1134 MP--CCPLLC 1141


>SB_15887| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 333

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +2

Query: 329 CCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           CC + GI      + + CS+P S +   P SCCI
Sbjct: 138 CCGAKGINDWDKNIYFNCSSPGSEACGVPYSCCI 171


>SB_59233| Best HMM Match : Involucrin (HMM E-Value=2.5)
          Length = 138

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           G    +Q+E  E ++ +  ++Q QH   ++ +  LL QQE
Sbjct: 89  GDEVRLQREMLEQQQKIIKMQQQQHQQHEEQQQRLLKQQE 128


>SB_57079| Best HMM Match : DUF1140 (HMM E-Value=3.8)
          Length = 235

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +QQ+  E  + +   +Q Q     Q + P   QQ     L+QQ++Q++ QL +QQM
Sbjct: 166 LQQKNTEMMQAMVQQQQQQQQQQPQQQQPQQ-QQLQQQQLQQQQLQQQ-QLQQQQM 219


>SB_53775| Best HMM Match : Involucrin2 (HMM E-Value=7.1e-12)
          Length = 1879

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = -1

Query: 429  MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
            M+Q+Q    EP+  +EQHQ S  +        Q+E    +EQQ+  +
Sbjct: 1737 MKQQQTSQEEPILSMEQHQTSQEEPILSMEQQQKESGLCVEQQQTSK 1783


>SB_38826| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 505

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQH--QHSMAKQHRMPLLGQ 331
           L H G + H   + G+C    + L+ H   H+  K HR P  G+
Sbjct: 347 LTHTGEKPHQCPQCGKCFALASSLKTHALTHTGEKPHRCPQCGK 390


>SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092)
          Length = 813

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 8/109 (7%)
 Frame = +2

Query: 248 PLC-NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           P+C N++ C+    +  T  C +     C P SG+     I  +   +P S +    CS 
Sbjct: 112 PVCDNAVKCNQKRYICAT--CKDTSHARCAPISGL----NIKTFRSDSPRSWT----CSN 161

Query: 425 CICCRLPIW-------SSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTK 550
           C+   +P +       S  S   PV   + +C++ E+EH+  +  + T+
Sbjct: 162 CLLSEMPFFGQRFLNTSGLSDGNPVDDDSHLCALKEREHQLKIMHINTQ 210


>SB_14707| Best HMM Match : A_deamin (HMM E-Value=0)
          Length = 1243

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q+ QQ Q + R+    L+Q Q    KQH   L  Q++    L+QQ++Q   Q  +QQ +
Sbjct: 252 QYQQQPQQQ-RQQRQQLQQQQIQHHKQH---LQQQRQQRQQLQQQQIQHHKQHLQQQRQ 306


>SB_7444| Best HMM Match : Transposase_1 (HMM E-Value=9.4)
          Length = 167

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +QQ+  E  + +   +Q Q     Q + P   QQ     L+QQ++Q++ QL +QQM
Sbjct: 98  LQQKNTEMMQAMVQQQQQQQQQQPQQQQPQQ-QQLQQQQLQQQQLQQQ-QLQQQQM 151


>SB_7210| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 869

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = -1

Query: 519 CSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHS 367
           C+  S + +LV I T +   V+   GSR    +  G   + +   E HQHS
Sbjct: 680 CTAVSADDSLVPISTESSFPVVSLTGSRIRNDKYDGTGLKAVLHSEDHQHS 730


>SB_54394| Best HMM Match : Keratin_B2 (HMM E-Value=1.1)
          Length = 245

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C LP +S++SS+ P +  T VC
Sbjct: 21  CALPCFSNSSSSLPCYAATEVC 42


>SB_44426| Best HMM Match : Lectin_legB (HMM E-Value=4.8)
          Length = 439

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 407 HSPCSCCICCRLPIWSSTSST 469
           +S   CCI    P+WSS+ ST
Sbjct: 97  YSELPCCISSSTPVWSSSRST 117


>SB_32228| Best HMM Match : zf-C4 (HMM E-Value=6.2e-23)
          Length = 300

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%)
 Frame = -1

Query: 159 LRYSLSVSHVGWSNQR-SSGYCWNSCDCTRFSSNYKGSSDEYDRF 28
           L Y + V  V WSN +     CW + +C+     Y G +  Y  +
Sbjct: 254 LTYGVFVCGVTWSNFKIKRNACWENTNCSTTRIRYPGLASFYSPY 298


>SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2077

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 12/31 (38%), Positives = 13/31 (41%), Gaps = 3/31 (9%)
 Frame = +2

Query: 254  CNSIC--CSYSCTLRCTFC-CSNRCGTSCCP 337
            C   C  C   C  +C    C NRCG  C P
Sbjct: 1939 CTKNCPPCQKQCENKCEHSKCKNRCGEPCVP 1969


>SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/61 (24%), Positives = 30/61 (49%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           S+   QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ 
Sbjct: 33  SKTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQQQQQQQQRQQQQQ 92

Query: 261 E 259
           +
Sbjct: 93  Q 93


>SB_41325| Best HMM Match : SWIM (HMM E-Value=0.015)
          Length = 950

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 10/32 (31%), Positives = 13/32 (40%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPAS 397
           CC+      C      LCC + L  C   PA+
Sbjct: 717 CCARALALQCASREPQLCCLSALTLCEKEPAA 748


>SB_29863| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 590

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 26/112 (23%), Positives = 45/112 (40%), Gaps = 9/112 (8%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFC--CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           P P+C     +  C  +   C  C +     C P SG+     I  +   +P S +    
Sbjct: 75  PAPVCPVCDKAVKCNQKRYVCATCKDTTHARCAPISGL----NIKTFRSDSPRSWT---- 126

Query: 416 CSCCICCRLPIW-------SSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTK 550
           CS C+   +P +       S  S   PV     +C++ E+EH+  +  + T+
Sbjct: 127 CSNCLLSEMPFFGQRSLNTSGLSDGNPVGDDFHLCALKEREHQLKIMHINTQ 178


>SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1387

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 1/27 (3%)
 Frame = +2

Query: 278  SCTLRCTFCCSNRCGTSCCP-SSGILC 355
            SC  +C   C   C + CC  + G LC
Sbjct: 1219 SCPAKCASQCDKSCPSECCSRAKGALC 1245


>SB_16746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 613

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = -1

Query: 354 HRMPLLGQQEVPHLLE--QQKVQRRVQL*EQQMELHR 250
           HR     QQ++P  +   QQ++QRRV+  E Q +LHR
Sbjct: 17  HRRVREAQQQLPRRVRGAQQQLQRRVR--EAQQQLHR 51


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,891,733
Number of Sequences: 59808
Number of extensions: 336743
Number of successful extensions: 2011
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 1242
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1706
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1584657875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).