SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.)             117   7e-27
SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.)             117   7e-27
SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.)             117   7e-27
SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.)             117   9e-27
SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.)             117   9e-27
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)             116   2e-26
SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.)             115   3e-26
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)             115   3e-26
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                      115   3e-26
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                         115   3e-26
SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09)            114   5e-26
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                    114   6e-26
SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63)                   114   6e-26
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)            113   8e-26
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                  113   8e-26
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)                      113   8e-26
SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)               113   8e-26
SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)                   113   8e-26
SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_46412| Best HMM Match : HEAT (HMM E-Value=8)                       113   8e-26
SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)                    113   8e-26
SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)                   113   8e-26
SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2)            113   8e-26
SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)              113   8e-26
SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78)             113   8e-26
SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)            113   8e-26
SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_34793| Best HMM Match : TIL (HMM E-Value=4.5)                      113   8e-26
SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6)                   113   8e-26
SB_31658| Best HMM Match : Arm (HMM E-Value=0.91)                     113   8e-26
SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)                    113   8e-26
SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4)             113   8e-26
SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021)                  113   8e-26
SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3)                  113   8e-26
SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_24859| Best HMM Match : HAP (HMM E-Value=6.4)                      113   8e-26
SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3)                   113   8e-26
SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7)              113   8e-26
SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05)                  113   8e-26
SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)          113   8e-26
SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1)                      113   8e-26
SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06)                  113   8e-26
SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07)                  113   8e-26
SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9)                      113   8e-26
SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2)                 113   8e-26
SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   8e-26
SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5)              113   8e-26
SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5)                   113   8e-26
SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8)            113   8e-26
SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55)                 113   8e-26
SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051)               113   8e-26
SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08)             113   8e-26
SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3)                  113   8e-26
SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)              113   8e-26
SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43)              113   8e-26
SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   8e-26
SB_8032| Best HMM Match : IBB (HMM E-Value=0.46)                      113   8e-26
SB_7769| Best HMM Match : Histone (HMM E-Value=0.2)                   113   8e-26
SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23)                    113   8e-26
SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2)                  113   8e-26
SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5)                    113   8e-26
SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043)                  113   8e-26
SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_46308| Best HMM Match : IMS (HMM E-Value=0)                        113   1e-25
SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6)              113   1e-25
SB_22468| Best HMM Match : CUT (HMM E-Value=6.8)                      113   1e-25
SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39)                  113   1e-25
SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8)                    113   1e-25
SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26)               113   1e-25
SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2)                 113   1e-25
SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3)                 113   1e-25
SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25)            113   1e-25
SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10)               113   1e-25
SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7)            113   1e-25
SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   1e-25
SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.)              113   1e-25
SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)          112   2e-25
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)         112   2e-25
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)          112   2e-25
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                  112   2e-25
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                     112   2e-25
SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)               112   2e-25
SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                        112   2e-25
SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)             112   2e-25
SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038)                    112   2e-25
SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8)                    112   2e-25
SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_23850| Best HMM Match : SMP (HMM E-Value=4.9)                      112   2e-25
SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015)                   112   2e-25
SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6)            112   2e-25
SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9)                112   2e-25
SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6)                112   2e-25
SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5)                112   2e-25
SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9)          112   2e-25
SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_16189| Best HMM Match : rve (HMM E-Value=0.3)                      112   2e-25
SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21)                112   2e-25
SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3)                  112   2e-25
SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_12434| Best HMM Match : SAB (HMM E-Value=4.6)                      112   2e-25
SB_12355| Best HMM Match : IncA (HMM E-Value=2)                       112   2e-25
SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023)          112   2e-25
SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71)                  112   2e-25
SB_7630| Best HMM Match : CAT (HMM E-Value=0)                         112   2e-25
SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_4868| Best HMM Match : BA14K (HMM E-Value=10)                      112   2e-25
SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.)              112   2e-25
SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9)                      112   2e-25
SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.)               112   2e-25
SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.)               112   2e-25
SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.)               112   2e-25
SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.)               112   2e-25
SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.)               112   2e-25
SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.)                112   2e-25
SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59172| Best HMM Match : SecG (HMM E-Value=9.5)                     112   2e-25
SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5)                  112   2e-25
SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07)                  112   2e-25
SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08)                  112   2e-25
SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1)                   112   2e-25
SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7)             112   2e-25
SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9)                 112   2e-25
SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7)                     112   2e-25
SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5)                   112   2e-25
SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25
SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   2e-25

>SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score =  117 bits (282), Expect = 7e-27
 Identities = 52/60 (86%), Positives = 56/60 (93%)
 Frame = +1

Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 35  TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 94


>SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score =  117 bits (282), Expect = 7e-27
 Identities = 52/60 (86%), Positives = 56/60 (93%)
 Frame = +1

Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 45  TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 104


>SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  117 bits (282), Expect = 7e-27
 Identities = 52/60 (86%), Positives = 56/60 (93%)
 Frame = +1

Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 72  TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131


>SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score =  117 bits (281), Expect = 9e-27
 Identities = 51/55 (92%), Positives = 54/55 (98%)
 Frame = +1

Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 15  TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69


>SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score =  117 bits (281), Expect = 9e-27
 Identities = 51/55 (92%), Positives = 54/55 (98%)
 Frame = +1

Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 25  TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  116 bits (278), Expect = 2e-26
 Identities = 51/59 (86%), Positives = 52/59 (88%)
 Frame = -1

Query: 389 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYRANW 213
           +LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF      K RPVNCNTTHYRANW
Sbjct: 22  QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80


>SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1580

 Score =  115 bits (277), Expect = 3e-26
 Identities = 60/96 (62%), Positives = 66/96 (68%)
 Frame = +1

Query: 133  YILDVYFFCISVIKDVYKRRLEGGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRLA 312
            Y+ D Y  C  +  DV K    GG   +       L     VLQRRDWENPGVTQLNRLA
Sbjct: 1027 YVPDAYEPCKLITSDV-KPLPSGGDPLESTCRHASLALAV-VLQRRDWENPGVTQLNRLA 1084

Query: 313  AHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 420
            AHPPFASWRNSEEARTDRPSQQLRSLNGEW+++  N
Sbjct: 1085 AHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score =  115 bits (276), Expect = 3e-26
 Identities = 53/63 (84%), Positives = 53/63 (84%)
 Frame = -1

Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYR 222
           HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW   GF      K RPVNCNTTHYR
Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645

Query: 221 ANW 213
           ANW
Sbjct: 646 ANW 648


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score =  115 bits (276), Expect = 3e-26
 Identities = 53/63 (84%), Positives = 53/63 (84%)
 Frame = -1

Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYR 222
           HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW   GF      K RPVNCNTTHYR
Sbjct: 32  HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88

Query: 221 ANW 213
           ANW
Sbjct: 89  ANW 91


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score =  115 bits (276), Expect = 3e-26
 Identities = 53/63 (84%), Positives = 53/63 (84%)
 Frame = -1

Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYR 222
           HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW   GF      K RPVNCNTTHYR
Sbjct: 32  HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88

Query: 221 ANW 213
           ANW
Sbjct: 89  ANW 91


>SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09)
          Length = 657

 Score =  114 bits (275), Expect = 5e-26
 Identities = 55/92 (59%), Positives = 68/92 (73%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKF 435
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L   
Sbjct: 37  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHL 96

Query: 436 ALNFC*ISSFFNQ*AEIGKIPYKSKNRPEIGL 531
             +     S F Q + + ++   S++   +G+
Sbjct: 97  CASTEIPRSTFTQASSVQRLFGTSQDDAGVGV 128


>SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 917

 Score =  114 bits (274), Expect = 6e-26
 Identities = 51/62 (82%), Positives = 55/62 (88%)
 Frame = +1

Query: 256  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKF 435
            VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L   
Sbjct: 836  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHL 895

Query: 436  AL 441
             L
Sbjct: 896  IL 897


>SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63)
          Length = 187

 Score =  114 bits (274), Expect = 6e-26
 Identities = 58/87 (66%), Positives = 60/87 (68%), Gaps = 3/87 (3%)
 Frame = +1

Query: 151 FFCISVIK---DVYKRRLEGGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRLAAHP 321
           FFCI  ++       R        QFAL          VLQRRDWENPGVTQLNRLAAHP
Sbjct: 61  FFCIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHP 120

Query: 322 PFASWRNSEEARTDRPSQQLRSLNGEW 402
           PFASWRNSEEARTDRPSQQLRSLNGEW
Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEW 147


>SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 65  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121


>SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 28  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84


>SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 52  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108


>SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 31  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87


>SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)
          Length = 195

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 117 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173


>SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 42  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98


>SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)
          Length = 349

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 14  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70


>SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 91  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147


>SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 25  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81


>SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)
          Length = 234

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 156 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212


>SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 60  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116


>SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 50  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 106


>SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 63  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119


>SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1615

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 216 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272


>SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 51  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107


>SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 43  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99


>SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 78  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134


>SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 25  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81


>SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 60  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116


>SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)
          Length = 318

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLK 432
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +  K
Sbjct: 103 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAK 161


>SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)
          Length = 154

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 76  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132


>SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 31  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87


>SB_46412| Best HMM Match : HEAT (HMM E-Value=8)
          Length = 140

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 62  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118


>SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 91  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147


>SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)
          Length = 181

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 103 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159


>SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 35  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91


>SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 128 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184


>SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 99  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155


>SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 64  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120


>SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 87  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143


>SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)
          Length = 165

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 87  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143


>SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 87  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143


>SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 68  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124


>SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 27  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83


>SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 111 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167


>SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 94

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 27  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83


>SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 46  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102


>SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 79  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135


>SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 70  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126


>SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 94  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150


>SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 44  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100


>SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 215

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 137 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193


>SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2)
          Length = 263

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 185 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241


>SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 62  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118


>SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)
          Length = 227

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 149 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205


>SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 61  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117


>SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78)
          Length = 197

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 119 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175


>SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 26  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82


>SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)
          Length = 1060

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 655 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711


>SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 42  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98


>SB_34793| Best HMM Match : TIL (HMM E-Value=4.5)
          Length = 242

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 164 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220


>SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 25  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81


>SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 73  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129


>SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 74  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130


>SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6)
          Length = 160

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 82  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138


>SB_31658| Best HMM Match : Arm (HMM E-Value=0.91)
          Length = 249

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 188 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244


>SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)
          Length = 633

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 447 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503


>SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4)
          Length = 154

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 76  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132


>SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021)
          Length = 546

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 269 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325


>SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 37  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93


>SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 73  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129


>SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3)
          Length = 185

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 107 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163


>SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 66  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122


>SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 76  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132


>SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 76  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132


>SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 77  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133


>SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 86  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142


>SB_24859| Best HMM Match : HAP (HMM E-Value=6.4)
          Length = 257

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 179 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235


>SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 34  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90


>SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3)
          Length = 164

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 86  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142


>SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 52  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108


>SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 71  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127


>SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 60  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116


>SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 72  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128


>SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 108

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 41  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97


>SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 47  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103


>SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7)
          Length = 143

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 65  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121


>SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05)
          Length = 162

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 84  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140


>SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 90  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146


>SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 185

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 107 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163


>SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 108

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 41  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97


>SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 53  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109


>SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 52  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108


>SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)
          Length = 207

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 129 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185


>SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 72  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128


>SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 58  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114


>SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 57  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113


>SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 91  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147


>SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 58  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114


>SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 97  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153


>SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 68  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124


>SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 248

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 170 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226


>SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 82  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138


>SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 60  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116


>SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1)
          Length = 186

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 108 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164


>SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 39  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95


>SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 200

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 122 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178


>SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06)
          Length = 233

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 155 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211


>SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07)
          Length = 183

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 105 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161


>SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 115

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 37  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93


>SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 40  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96


>SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9)
          Length = 150

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 72  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128


>SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 207

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 129 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185


>SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2)
          Length = 322

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 29  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85


>SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 74  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130


>SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 88  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144


>SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5)
          Length = 174

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 96  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152


>SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 75  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131


>SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5)
          Length = 174

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 96  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152


>SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 110 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166


>SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8)
          Length = 162

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 84  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140


>SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55)
          Length = 189

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 111 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167


>SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051)
          Length = 387

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 309 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365


>SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 55  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111


>SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08)
          Length = 688

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 18  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74


>SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 96

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 29  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85


>SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 59  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115


>SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 328

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 250 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306


>SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 176

 Score =  113 bits (273), Expect = 8e-26
 Identities = 60/97 (61%), Positives = 64/97 (65%), Gaps = 10/97 (10%)
 Frame = +1

Query: 142 DVYFFCISVIKDVYKRRLEGGPGT----------QFAL**VVLQFTGRVLQRRDWENPGV 291
           D+YF C+   K   +    GG  +          QFAL          VLQRRDWENPGV
Sbjct: 40  DLYFVCLMTPKSTIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGV 99

Query: 292 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 402
           TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW
Sbjct: 100 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136


>SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 84  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140


>SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 51  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107


>SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 27  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83


>SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 268

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 207 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263


>SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 66  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122


>SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)
          Length = 783

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 722 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778


>SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 42  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98


>SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 551

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 190 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246


>SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43)
          Length = 511

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 118 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 174


>SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 33  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 89


>SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 79


>SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 88  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144


>SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 35  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91


>SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 190

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 112 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 168


>SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 24  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80


>SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 40  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96


>SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 63  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119


>SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 24  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80


>SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 44  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100


>SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 70  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126


>SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 47  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103


>SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 65  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121


>SB_8032| Best HMM Match : IBB (HMM E-Value=0.46)
          Length = 191

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 124 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 180


>SB_7769| Best HMM Match : Histone (HMM E-Value=0.2)
          Length = 150

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 72  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128


>SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23)
          Length = 940

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 367 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 423


>SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2)
          Length = 267

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 44  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100


>SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5)
          Length = 144

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 57  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113


>SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043)
          Length = 630

 Score =  113 bits (273), Expect = 8e-26
 Identities = 50/57 (87%), Positives = 54/57 (94%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 440 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 496


>SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score =  113 bits (272), Expect = 1e-25
 Identities = 50/60 (83%), Positives = 54/60 (90%)
 Frame = +1

Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426
           TGR   RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++   +L
Sbjct: 40  TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99


>SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 32  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83


>SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 21  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72


>SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 22  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73


>SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 40  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91


>SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 135 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186


>SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 24  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75


>SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 36  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87


>SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 562

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 149 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200


>SB_46308| Best HMM Match : IMS (HMM E-Value=0)
          Length = 1245

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
            VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 1193 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244



 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = -1

Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 294
           HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW
Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439


>SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 80  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131


>SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 34  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85


>SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 89

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 37  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88


>SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 39  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90


>SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 43  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94


>SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 24  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75


>SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 20  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71


>SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 34  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85


>SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 397

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 173 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 224


>SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 22  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73


>SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 102

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 50  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101


>SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 35  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86


>SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 61  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112


>SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 20  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71


>SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 115

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 63  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114



 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 29/32 (90%), Positives = 32/32 (100%)
 Frame = +1

Query: 304 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 399
           +++AHPPFASWRNSEEARTDRPSQQLRSLNGE
Sbjct: 14  QVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45


>SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 116

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 64  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115


>SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 20  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71


>SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6)
          Length = 128

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 76  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127


>SB_22468| Best HMM Match : CUT (HMM E-Value=6.8)
          Length = 197

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 145 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196


>SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39)
          Length = 571

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 194 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245


>SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 96

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 44  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95


>SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 25  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76


>SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 46  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97


>SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 21  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72


>SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 61  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112


>SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 65  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116


>SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 45  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96


>SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 20  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71


>SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 36  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87


>SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 89

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 37  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88


>SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 49  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100


>SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 29  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80


>SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 58  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109


>SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 59  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110


>SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 211

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 159 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 210


>SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8)
          Length = 82

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 30  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81


>SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 61  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112


>SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 92  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 143


>SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 21  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72


>SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 47  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98


>SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 200

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 148 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 199


>SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26)
          Length = 1064

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 794 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 845


>SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2)
          Length = 110

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 58  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109


>SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 85

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 33  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84


>SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3)
          Length = 292

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 56  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 107


>SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 21  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72


>SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 90

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 38  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 89


>SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score =  113 bits (272), Expect = 1e-25
 Identities = 58/91 (63%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = +1

Query: 139 LDVYFFCISVIK---DVYKRRLEGGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRL 309
           L++  FCI  ++       R        QFAL          VLQRRDWENPGVTQLNRL
Sbjct: 9   LNMIVFCIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRL 68

Query: 310 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 402
           AAHPPFASWRNSEEARTDRPSQQLRSLNGEW
Sbjct: 69  AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 99


>SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25)
          Length = 1137

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 532 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 583


>SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 40  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91


>SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 14  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65


>SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10)
          Length = 567

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 201 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 252


>SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7)
          Length = 132

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 54  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 105


>SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


>SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 30  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81


>SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 27  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78


>SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 43  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94


>SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 23  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74


>SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 39  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90


>SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  113 bits (272), Expect = 1e-25
 Identities = 49/52 (94%), Positives = 52/52 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 19  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,605,038
Number of Sequences: 59808
Number of extensions: 408752
Number of successful extensions: 5019
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 4857
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5006
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1499981500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).