SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             192   3e-49
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              192   3e-49
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         192   3e-49
SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      192   3e-49
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              185   2e-47
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             126   1e-29
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)             109   2e-24
SB_54| Best HMM Match : Actin (HMM E-Value=0)                         100   1e-21
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             83   2e-16
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  73   3e-13
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   2e-09
SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)                     56   2e-08
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 52   4e-07
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               46   3e-05
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.58 
SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)                 31   0.77 
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      31   0.77 
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)                 31   1.0  
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        31   1.0  
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    31   1.0  
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   1.0  
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.0  
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    30   1.3  
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  30   1.8  
SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)                 29   2.4  
SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2)                    29   2.4  
SB_39407| Best HMM Match : TIG (HMM E-Value=0)                         29   3.1  
SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)                    28   5.4  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)                  28   5.4  
SB_4077| Best HMM Match : PDZ (HMM E-Value=3.5e-18)                    28   5.4  
SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              28   5.4  
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.4  
SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)                   28   5.4  
SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)                 28   5.4  
SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)                 28   5.4  
SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              28   5.4  
SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_34900| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-12)                 27   9.5  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085)        27   9.5  
SB_26826| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  

>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  192 bits (467), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 173



 Score =  128 bits (309), Expect = 4e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  192 bits (467), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  125 bits (302), Expect = 3e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  192 bits (467), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 1e-29
 Identities = 58/60 (96%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  192 bits (467), Expect = 3e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 173



 Score =  132 bits (320), Expect = 2e-31
 Identities = 60/62 (96%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  185 bits (451), Expect = 2e-47
 Identities = 84/86 (97%), Positives = 86/86 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           QIMFETFN+PAMYVAIQAVLSLYASG
Sbjct: 122 QIMFETFNSPAMYVAIQAVLSLYASG 147



 Score =  128 bits (309), Expect = 4e-30
 Identities = 57/62 (91%), Positives = 61/62 (98%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTGIV+D GDGV HTVPIYE
Sbjct: 148 RTTGIVMDSGDGVSHTVPIYE 168


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  126 bits (305), Expect = 1e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 33/58 (56%), Positives = 38/58 (65%)
 Frame = +3

Query: 414 NREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           N + M +IMFETFN+PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 78  NWDDMEKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 135



 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 26/30 (86%), Positives = 27/30 (90%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTF 341
           +RGILTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIMFETF 90


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score =  109 bits (261), Expect = 2e-24
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANRE 422
           ++ R +L + YP+++GIV NWDDM+ +W +TF  +++ + P    VLLTE PLNP  NRE
Sbjct: 62  SQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNPMKNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           KM ++MFE +    +Y+AIQAVL+LYA G+       S    +  CP  +G+ALP
Sbjct: 122 KMIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGDGVTHICPVYEGFALP 176



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEA 246
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VGDEA
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDEA 61


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score =  100 bits (239), Expect = 1e-21
 Identities = 49/89 (55%), Positives = 61/89 (68%)
 Frame = +3

Query: 321  KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
            K+W H F ++LRV  E+ PVLLTEAPLNPK NRE+M Q+MFE+FN P MYVA+QAV++LY
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMALY 2188

Query: 501  ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            ASG    + +      S   P   GY LP
Sbjct: 2189 ASGRTTGTVFDCGDGVSHTVPVYDGYWLP 2217



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +1

Query: 94   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 195
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 39/78 (50%), Positives = 54/78 (69%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVS 548
           +HPVLLTEAPLNP+ NREK  ++ FETFN PA+++++QAVLSLYA+G        +    
Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDGV 185

Query: 549 STPCPFTKGYALPPRHSL 602
           S   P  +G+A+P  HS+
Sbjct: 186 SHSVPIYEGFAMP--HSI 201


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 33/102 (32%), Positives = 57/102 (55%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA  N +  REK+T++MFE +N 
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLTELMFEKYNV 62

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   +VL+ +A+G        S    ++  P   GY L
Sbjct: 63  PAFFLCKNSVLTAFANGRSNGLVIDSGATQTSAVPVHDGYVL 104


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +1

Query: 79   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 195
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)
          Length = 152

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 30/51 (58%), Positives = 34/51 (66%)
 Frame = +3

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           IMFE FN+PA+YVAIQAVLSLYASG      + S    S   P  +GYALP
Sbjct: 1   IMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDGVSHNVPIYEGYALP 51


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 3/67 (4%)
 Frame = +1

Query: 64  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYV 234
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKY 752

Query: 235 GDEAQSK 255
           GD A +K
Sbjct: 753 GDAAVAK 759


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 386
           K+PI H IV +WD ME+ W    +  LR  PE+H  LL
Sbjct: 299 KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPI 565
           R  TG V+D GDGV H +P+
Sbjct: 353 RTLTGCVIDSGDGVTHVIPV 372


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -1

Query: 192 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 76
           MA  + D GE+G+ SI+S ETGLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP--EEHPVLLTEAPLNPKANRE 422
           L+ P +  +VT+++  E++  H F +     P    HPV++TE   NP   R+
Sbjct: 131 LRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGGVNHPVIMTEPVCNPNYCRQ 183


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -2

Query: 167 GNTARGASSPAKPALHIPEPLSTT 96
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -2

Query: 167 GNTARGASSPAKPALHIPEPLSTT 96
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)
          Length = 543

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TG V+D GDGV H +P+ E
Sbjct: 59  RTLTGCVIDSGDGVTHVIPVAE 80


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 213 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 408 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454


>SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)
          Length = 892

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 5/73 (6%)
 Frame = -1

Query: 258 LFALCLISYI--RVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQ 94
           +FA CL   +   V+LSH + H L A       +HG R+  SCET L    H  A +  +
Sbjct: 461 IFATCLACKVMKHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNK 519

Query: 93  RGNFFVAHLELVK 55
            G   V  L+  K
Sbjct: 520 HGQVDVLLLDFQK 532


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 271 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 249 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295


>SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 91  LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 402

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 91  LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 125 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -2

Query: 167 GNTARGASSPAKPALHIPEPLSTT 96
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1259

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +2

Query: 395 SPQPQGQQREDDPDHVRNIQHARHVRRHPSR 487
           SP P+   R D+P  V     A HV  HPSR
Sbjct: 265 SPTPKRCVRFDEPPTVEKYSKASHVTEHPSR 295


>SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)
          Length = 570

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/48 (37%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 173 LTCICCKVMEHIVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNE 350
           P + G + NWD  ++IW +TF  E
Sbjct: 292 PFQKGFLVNWDVEKQIWDYTFGKE 315



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAV 162
           ++A LV+D G+   K GFA + APR++
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258


>SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)
          Length = 186

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 2/91 (2%)
 Frame = -3

Query: 373 CSSGATRSSL*KV*CQIFSMSSQLVTIPCSMG--YLRVRIPLCSVPHLLHKSPSVPYRPS 200
           CS       +  + C    +  ++V   CS    Y+ V   +CS   + H+       PS
Sbjct: 88  CSPSRAHVDVFPITCSCRCVPHRMVMSMCSPSRVYVDVSPIVCSCRCVPHRVLMSMCSPS 147

Query: 199 RPDGGAFPRSRGTRREEHHLLRNRPCTYRSH 107
           R D   FP +   R   HH+L +   + R+H
Sbjct: 148 RADVDVFPITCSRRCVFHHVLMSMCSSSRAH 178


>SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2)
          Length = 563

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/31 (38%), Positives = 15/31 (48%)
 Frame = +1

Query: 439 CSKHSTRPPCTSPSKPCSRCTRPAYHRYRAG 531
           C  H+ R P T+PS PC      +   Y AG
Sbjct: 360 CYSHARREPSTAPSLPCDLVAATSAKMYLAG 390


>SB_39407| Best HMM Match : TIG (HMM E-Value=0)
          Length = 1710

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +3

Query: 456  TPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPC 560
            TP   +  Q V++LY SG P  +   + T+ ST C
Sbjct: 1300 TPTTILGKQNVITLYGSGFPAKTSDVTVTLGSTAC 1334


>SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)
          Length = 419

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 242 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 288


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -2

Query: 167 GNTARGASSPAKPALHIPEPLSTT 96
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3176

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = -3

Query: 319 SMSSQLVTIPCSMGYLRVRIPLCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHL 140
           +++SQ VT    M   R  +PL S P  + KSP V + P  PD  +  R      E HH 
Sbjct: 792 ALTSQQVTSSHDMP--RTSMPLVSYPPHMKKSPFVVHHP--PDSAS--RHGNQAPEAHH- 844

Query: 139 LRNRPCTYRS 110
             + P +Y+S
Sbjct: 845 --HEPGSYKS 852


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -2

Query: 167 GNTARGASSPAKPALHIPEPLSTT 96
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +3

Query: 162 VPLDRGKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNW--DDMEKIWHH 335
           V L +     +GR+   G+   +CR+    +  ++TL + I  G+  +   D  EK+W+H
Sbjct: 441 VTLSQNVVSVTGREESGGSGTQVCRK----KAPLITLSHVIRMGLALSLVSDVKEKVWYH 496

Query: 336 TFYN 347
           T  N
Sbjct: 497 TCPN 500


>SB_4077| Best HMM Match : PDZ (HMM E-Value=3.5e-18)
          Length = 458

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 21/71 (29%), Positives = 30/71 (42%)
 Frame = +2

Query: 353 ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRRTTGIVLD 532
           ACR R  P       P P+  + ++D D   +I   R     P R + V   +T G+ + 
Sbjct: 205 ACRGRKDPRNKPPQPPPPEPTENDEDAD---SISRKRRGIGEP-RTVIVNKDKTEGLGIS 260

Query: 533 FGDGVFHTVPI 565
              G  H VPI
Sbjct: 261 ITGGKEHGVPI 271


>SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 103 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 149


>SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2396

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258  LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
            L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 1641 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 1687


>SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 859

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 669 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 715


>SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3142

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  LC  +   ++LSH + H L         +HG R  +SCET L  T
Sbjct: 854 LTCLCCKTMEHIVLSHLNKH-LSRFNILSNAQHGFRQGLSCETQLVLT 900


>SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)
          Length = 329

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 224 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 270


>SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)
          Length = 1492

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258  LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
            L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 1079 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 1125


>SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)
          Length = 452

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 22  LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 68


>SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -1

Query: 258 LFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 115
           L  +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 103 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 149


>SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4856

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 9/54 (16%)
 Frame = -3

Query: 310  SQLVTIPCSMGYLRVRIPLCSVPHLLHKS---------PSVPYRPSRPDGGAFP 176
            S+ ++IP   G+ R    L   P L H S         P+ PY PS+  G +FP
Sbjct: 3759 SKPISIPSRDGHARAATSLPGSPQLSHLSGRFSSDDVSPTPPYSPSQKQGFSFP 3812


>SB_34900| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-12)
          Length = 433

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +3

Query: 423 KMTQIMFETFNTPAMYVAIQ---AVLSLYASGVPPVSCWT-SATVSS 551
           K  +I+  TF   A++       A   LY S +PP +CW  S T+ S
Sbjct: 217 KNRRIIAMTFTVVALFTLTWGPIATTPLYISAIPPNACWNLSPTIQS 263


>SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = -2

Query: 182 LPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 72
           L  IE +    A++P  P + +P+ +   +AAT +SH
Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258


>SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 617

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -3

Query: 238 LLHKSPSVPYRPS--RPDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLLPT 92
           LL +S   P +P+  RP GGA P++    ++   +  N+  T+      PT
Sbjct: 92  LLDESTEAPPQPATIRPQGGALPQTPVKGKQNKRVSDNKEFTHAMQARRPT 142


>SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085)
          Length = 350

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = -2

Query: 584 KCVSFRKWARCGRHRRRSPARYRWYAGRVQR 492
           KC    K+  C R+RRR   RY++Y G+ +R
Sbjct: 125 KCFCKVKYYHC-RYRRRCVWRYKYYHGKPRR 154


>SB_26826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 221

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 18/57 (31%), Positives = 25/57 (43%)
 Frame = -3

Query: 244 PHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLLPTRQLLRR 74
           P  L  +P +  RPS      +  S  +      LL  RP TYR+   LP+  LL +
Sbjct: 131 PLYLPSAPLLTERPSTYRAPLYLPSAPSTYRAPLLLTERPSTYRAPLYLPSTPLLTK 187


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,051,110
Number of Sequences: 59808
Number of extensions: 604697
Number of successful extensions: 2150
Number of sequences better than 10.0: 54
Number of HSP's better than 10.0 without gapping: 1879
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2131
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1572561250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).