SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.075
SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45)              34   0.099
SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22)               34   0.099
SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.13 
SB_34586| Best HMM Match : Drf_FH1 (HMM E-Value=0.088)                 33   0.17 
SB_55690| Best HMM Match : AAA (HMM E-Value=0)                         32   0.40 
SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.53 
SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3)               31   0.92 
SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.92 
SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38)                30   1.2  
SB_48872| Best HMM Match : GASA (HMM E-Value=0.16)                     30   1.6  
SB_59480| Best HMM Match : ZU5 (HMM E-Value=2.4e-38)                   29   2.1  
SB_26474| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.8  
SB_133| Best HMM Match : Sushi (HMM E-Value=5e-40)                     29   2.8  
SB_7449| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.7  
SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15)                   28   4.9  
SB_31652| Best HMM Match : Peptidase_C2 (HMM E-Value=0)                28   6.5  
SB_49976| Best HMM Match : SEC-C (HMM E-Value=0.95)                    27   8.6  
SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08)         27   8.6  
SB_35802| Best HMM Match : Laminin_EGF (HMM E-Value=0.25)              27   8.6  
SB_28799| Best HMM Match : SEC-C (HMM E-Value=0.95)                    27   8.6  
SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.6  
SB_20396| Best HMM Match : SEC-C (HMM E-Value=1.5)                     27   8.6  

>SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 5659

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 17/62 (27%), Positives = 30/62 (48%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A +      +T ++ T V+S+  +  E TA+P +T  P   +    +  LET   P
Sbjct: 858  ETTVAPETTVEPETTVASKTTVASETTVTPEATATPELTAGPATTLAPTTIGALETTEAP 917

Query: 453  DY 458
            ++
Sbjct: 918  EF 919



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A +      +T    T +S +  +  E T +   T+TP+  +  +   E ET V+P
Sbjct: 2806 ESTVAPETTMAPETTVEPETTLSPETTVAPETTVALGTTVTPETTVAPETTEEPETTVVP 2865

Query: 453  D 455
            +
Sbjct: 2866 E 2866



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/61 (26%), Positives = 29/61 (47%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A++      +T +  T V+ +     E T +   T+TP+  +  +   E ET V+P
Sbjct: 3146 ETTVASETTAEPDTTQAPETTVTPETTKAPETTVASETTVTPETTVAPETTEEPETTVVP 3205

Query: 453  D 455
            +
Sbjct: 3206 E 3206



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T   ++     ST ++ T V  +  ++ E T  P  T TP+  +  +     ET V+P
Sbjct: 3414 ETTALPESTVAPESTVASMTTVLPETTVVPETTVVPGTTPTPESTVAPETTVAPETTVIP 3473

Query: 453  D 455
            +
Sbjct: 3474 E 3474


>SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45)
          Length = 3094

 Score = 33.9 bits (74), Expect = 0.099
 Identities = 18/61 (29%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T AT++     +T S  T V+ +  +  E TA+P  T+ P+     +     ET   P
Sbjct: 2331 ESTAATESTVAPETTVSQETTVAPETTVPTETTAAPETTVAPEITFAPETTLPPETTAAP 2390

Query: 453  D 455
            D
Sbjct: 2391 D 2391



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T A +      +TP+  T  +S+  +  E T +P VTL P   +  +     ET   P
Sbjct: 506 ESTVAPEITVAPETTPALETTSASESTVATESTVAPEVTLPPGTTVAPETTVAPETTAAP 565

Query: 453 D 455
           +
Sbjct: 566 E 566



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 18/61 (29%), Positives = 27/61 (44%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T AT++     +T S  T V+ +  +  E TA+P  T+ P      +     ET   P
Sbjct: 368 ESTAATESTVAPETTVSQETTVAPETTVPTETTAAPETTVAPDITFAPETTVPPETTGAP 427

Query: 453 D 455
           D
Sbjct: 428 D 428



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 18/61 (29%), Positives = 27/61 (44%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T AT++     +T S  T V+ +  +  E TA+P  T+ P      +     ET   P
Sbjct: 1437 ESTAATESTVAPETTVSQETTVAPETTVPTETTAAPETTVAPDITFAPETTVPPETTGAP 1496

Query: 453  D 455
            D
Sbjct: 1497 D 1497



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/61 (24%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T   +   P  +T +  T  +    +  E TA+P+ T+ P+  +  +     ET V+P
Sbjct: 1871 ETTVVHETTAPPETTVAPETTAAPDTTVAGETTAAPDTTMAPEITVAPETTVAPETTVVP 1930

Query: 453  D 455
            +
Sbjct: 1931 E 1931



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A +      +TP+  T  +S+     E T +P VTL P   +  +     ET   P
Sbjct: 2812 ESTVAPEITVVPETTPALETTSASESTDATESTVAPEVTLPPGTTVAPETTVAPETTAAP 2871

Query: 453  D 455
            +
Sbjct: 2872 E 2872



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/61 (22%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T   +      +T +  T  + +  +  E TA+P+ T+ P+  +  +     ET V+P
Sbjct: 2127 ESTVPPETTVATETTVAPETTAAPESTLAPEITAAPDTTMVPESTVAPETTVAPETTVVP 2186

Query: 453  D 455
            +
Sbjct: 2187 E 2187



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 15/59 (25%), Positives = 27/59 (45%)
 Frame = +3

Query: 279  TNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMPD 455
            T A +      +T +  T V+ +     E TA+P  T+ P+        + LET ++P+
Sbjct: 2195 TVAQETTVAPETTVAPETTVAPETTAALETTAAPVTTMVPETTAAPATTAALETSIVPE 2253



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/61 (24%), Positives = 26/61 (42%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T A +      ST +  + V+ +  +  E  A+P+ T+ P+     +     ET   P
Sbjct: 804 ETTPALETTSAPESTAATESTVAPETTVPTETAAAPDTTVAPEITFAPETTVPPETTAAP 863

Query: 453 D 455
           D
Sbjct: 864 D 864


>SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22)
          Length = 3445

 Score = 33.9 bits (74), Expect = 0.099
 Identities = 18/61 (29%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T AT++     +T S  T V+ +  +  E TA+P  T+ P+     +     ET   P
Sbjct: 2689 ESTAATESTVAPETTVSQETTVAPETTVPTETTAAPETTVAPEITFAPETTVPPETTAAP 2748

Query: 453  D 455
            D
Sbjct: 2749 D 2749



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/61 (29%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T AT++     +T S  T V+ +  +  E TA+P  TL P+  +  +     E    P
Sbjct: 1729 ESTAATESTVAPETTVSQETTVAPETTVPTETTAAPETTLEPEITVAPETTVAPEITAAP 1788

Query: 453  D 455
            D
Sbjct: 1789 D 1789



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 23/84 (27%), Positives = 35/84 (41%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A     P  ST +  + ++ +     + T +P  T+ P   +  +  + LET V P
Sbjct: 1867 ETTTAPVTTLPPDSTMAPKSTLAPETTAAPDTTLAPETTVAPDTTVAPETTAALETTVAP 1926

Query: 453  DYRQNNRPYSDVRCRENYCFAEAT 524
            D      PY+ V   E    AE T
Sbjct: 1927 D--TTAAPYTTV-AAETTASAETT 1947



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 14/61 (22%), Positives = 28/61 (45%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T   +      +T +A T  + +  ++ E TA+P  + TP+  +  +  S   T + P
Sbjct: 2224 ETTMPPETTMAPETTVAAETTAAPETTVVPETTAAPETSATPETTMVPETTSAPSTTMAP 2283

Query: 453  D 455
            +
Sbjct: 2284 E 2284



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/61 (24%), Positives = 26/61 (42%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A +      +T +A T  + +     E +A+P+ T+ PQ           ET + P
Sbjct: 2923 ETTVAAETTAAAETTAAAETTAAPETTAAPETSAAPDTTMVPQTTSAPATTMAPETTLAP 2982

Query: 453  D 455
            +
Sbjct: 2983 E 2983


>SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1211

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 17/61 (27%), Positives = 29/61 (47%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T A +      +T  A T V+ +     E TA+P  T  P+  +  +  +E+ET + P
Sbjct: 602 ETTMAPETTTAPETTAKAETTVAPETSAAPETTAAPETTAAPETTMAPETTAEIETTMTP 661

Query: 453 D 455
           +
Sbjct: 662 E 662



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 15/59 (25%), Positives = 28/59 (47%)
 Frame = +3

Query: 279 TNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMPD 455
           T A +      +T ++ T V+S+     E TA+P+ ++ P+     +  +  ET   PD
Sbjct: 748 TAAPETTAEPETTAASETTVASETTAAPETTAAPDTSVAPETTAAPETTAAPETTAAPD 806



 Score = 27.9 bits (59), Expect = 6.5
 Identities = 16/61 (26%), Positives = 26/61 (42%)
 Frame = +3

Query: 273  EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
            E T A +      +T +  T  + +   + E TA+P  T TP+       L+  ET   P
Sbjct: 926  ETTAAPETTATPDTTAATETTAAPETTAVPETTAAPETTSTPETTSTPGTLAASETTAAP 985

Query: 453  D 455
            +
Sbjct: 986  E 986



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/60 (25%), Positives = 25/60 (41%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T A +      +T +  T  + +    +E TA+P  T  P+     +  + LET   P
Sbjct: 686 ETTAAPETTAAPETTAAPETTAAPETTSASETTAAPETTTAPETTAASETTAVLETTAAP 745


>SB_34586| Best HMM Match : Drf_FH1 (HMM E-Value=0.088)
          Length = 665

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 23/84 (27%), Positives = 35/84 (41%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T A     P  ST +  + ++ +     + T +P  T+ P   +  +  + LET V P
Sbjct: 66  ETTTAPVTTLPPDSTMAPKSTLAPETTAAPDTTLAPETTVAPDTTVAPETTAALETTVAP 125

Query: 453 DYRQNNRPYSDVRCRENYCFAEAT 524
           D      PY+ V   E    AE T
Sbjct: 126 D--TTAAPYTTV-AAETTASAETT 146



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 14/61 (22%), Positives = 28/61 (45%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T   +      +T +A T  + +  ++ E TA+P  + TP+  +  +  S   T + P
Sbjct: 411 ETTMPPETTMAPETTVAAETTAAPETTVIPETTAAPETSATPETTMVPETTSAPSTTMAP 470

Query: 453 D 455
           +
Sbjct: 471 E 471


>SB_55690| Best HMM Match : AAA (HMM E-Value=0)
          Length = 1031

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 237 QKSDCRRIMPNSEGTNATQAVFPVRSTPSAS 329
           Q+  C  I+ + EG N TQA FPV S P+ S
Sbjct: 176 QREPCATIL-SQEGRNGTQAAFPVTSIPNES 205


>SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4072

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +3

Query: 270 SEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTL 392
           SEGT A +   P  ST ++   V+S+  +  E T+SP++T+
Sbjct: 26  SEGTFAPRTTGPHESTVASGATVASKNTVTPETTSSPDITV 66



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +3

Query: 312  STPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMPD 455
            +T    T    +   + E TA+P  T  P+     K  + LET  +PD
Sbjct: 2240 TTAVPETTAVPETTAVPETTAAPETTAPPETTALPKTTAALETFSIPD 2287


>SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3)
          Length = 474

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 3/91 (3%)
 Frame = +3

Query: 210 RRRLDLEYYQKSDCRRIMPNSEGTN-ATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNV 386
           R R+ L  Y      R  P    T+  T A F   ++ +AST +++ P+  +  +++ + 
Sbjct: 114 RYRMMLARYFTGQISRPPPRPASTSLTTSAAFTSSTSSAASTSLTTSPVSTSSTSSAAST 173

Query: 387 TLTPQDLIYKKCLSEL--ETLVMPDYRQNNR 473
           +LTP   I     +E   +  ++P   Q  R
Sbjct: 174 SLTPAPNILSAAATECYSDEAIIPSTPQKKR 204


>SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3297

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 27/106 (25%), Positives = 41/106 (38%)
 Frame = +3

Query: 267  NSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLV 446
            N   T      FP+ +T   S+M S+QP   AE TAS   ++T         L E  T+ 
Sbjct: 1807 NKACTQVIATTFPLINTTGISSMASAQP-TTAETTASTPTSITSSPSSPSTILPETRTIP 1865

Query: 447  MPDYRQNNRPYSDVRCRENYCFAEATNTSAISGERMRIQSFQHPLL 584
              +  +     +            +T TS I  E +  Q+  H L+
Sbjct: 1866 KTNVVEGGAKITPKPSDAPAIPITSTGTSQIIEESITKQTSTHELI 1911


>SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38)
          Length = 839

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +3

Query: 273 EGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMP 452
           E T A +      +TP+  T  +S+     E T +P VTL P   +  +     ET   P
Sbjct: 557 ESTVAPEITVVPETTPALETTSASESTDATESTVAPEVTLPPGTTVAPETTVAPETTAAP 616

Query: 453 D 455
           +
Sbjct: 617 E 617


>SB_48872| Best HMM Match : GASA (HMM E-Value=0.16)
          Length = 144

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -3

Query: 319 GVERTGNTACVAFVPSEFGIILLQSDFW*YSRSNRL 212
           G ER+ N +C  F P   G I+ + D W    + +L
Sbjct: 100 GFERSANNSCKCFCPPRSGTIVPEKDSWRCKENGKL 135


>SB_59480| Best HMM Match : ZU5 (HMM E-Value=2.4e-38)
          Length = 903

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +3

Query: 369 TASPNVTLTPQDLIYKKCLSELETLVMPDYRQNNRPYSDVRCRENYCF 512
           T SP VTL P D+I+KK ++   T+  P Y   + P      R   CF
Sbjct: 435 TVSPVVTLEPADIIFKKPVT--VTIPCPVYSGQSNPDIQPSLRLLCCF 480


>SB_26474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +1

Query: 100 RNNYLFAFILMSFTVCTTIEQSGNLLT----LKKRTRRKIAEDDWIWSTTKSPTAEE 258
           + NY F   + SF    T  Q     T     K RTRR++  DD +  T  +PT  E
Sbjct: 16  KGNYTFDLTIRSFDGAETCRQFSTFTTPIPQQKCRTRRRLVCDDGLAITDATPTDTE 72


>SB_133| Best HMM Match : Sushi (HMM E-Value=5e-40)
          Length = 607

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/62 (25%), Positives = 27/62 (43%)
 Frame = +3

Query: 120 VYFDVVYRVHNN*TIWKPFNFEEADEKKNCRRRLDLEYYQKSDCRRIMPNSEGTNATQAV 299
           +Y D V+ +H +  I+        DE+K C+   D+ Y  +   R    +  GT+     
Sbjct: 457 IYRDAVFHLHKDDEIYVDSRVYADDERKFCKDPGDIPYGNRDKGRSDSSHRVGTSIRYWC 516

Query: 300 FP 305
           FP
Sbjct: 517 FP 518


>SB_7449| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -2

Query: 452 WHYQSFQF*KTFLINQVLRCKRNIW 378
           WH+ + QF  T LIN++  C+R  W
Sbjct: 93  WHFAALQFSDTRLINKI-ECRRKKW 116


>SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15)
          Length = 857

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +3

Query: 240 KSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPN 383
           K+D +    +S G N  +   P R+TP AST   +  L+M +    PN
Sbjct: 236 KTDQQSECESSPGANTDRLESPARTTPQASTPYGTS-LLMVKPDTLPN 282


>SB_31652| Best HMM Match : Peptidase_C2 (HMM E-Value=0)
          Length = 1133

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 21/81 (25%), Positives = 33/81 (40%)
 Frame = +3

Query: 138 YRVHNN*TIWKPFNFEEADEKKNCRRRLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRST 317
           YR+H    +  P  F    E  +   R+  E  Q + CR  +P +    A   V+P+   
Sbjct: 502 YRLHAGEYVVIPSTFNPGQEG-DFLLRIFSERPQYASCRIQVPTTHDLIAVATVYPLTHI 560

Query: 318 PSASTMVSSQPLIMAEGTASP 380
            S    V +   ++A GT  P
Sbjct: 561 DSCRIQVPTTHDLIAVGTGYP 581


>SB_49976| Best HMM Match : SEC-C (HMM E-Value=0.95)
          Length = 1037

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -1

Query: 246 RTFGSTPDPIVFCNFSS--RPLLQS*KVSRLFNCCAHGKR 133
           + FG  P PI+  + SS  R L +S  +  L  C  +G+R
Sbjct: 370 KVFGPDPPPIILADHSSRRRSLPESTNLYELLECPCYGRR 409


>SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08)
          Length = 1907

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = -2

Query: 578 RMLKALNSHSLTRYC*SVCCLSKTIIFSASDVTVRSVI 465
           ++   +N  +++R+C  VCC+ K  +   S V  R  +
Sbjct: 308 KLTNTVNGSTISRFCACVCCVIKASLLVESKVLNRKTL 345


>SB_35802| Best HMM Match : Laminin_EGF (HMM E-Value=0.25)
          Length = 781

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -1

Query: 246 RTFGSTPDPIVFCNFSS--RPLLQS*KVSRLFNCCAHGKR 133
           + FG  P PI+  + SS  R L +S  +  L  C  +G+R
Sbjct: 7   KVFGPDPPPIILADHSSRRRSLPESTNLYELLECPCYGRR 46


>SB_28799| Best HMM Match : SEC-C (HMM E-Value=0.95)
          Length = 710

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -1

Query: 246 RTFGSTPDPIVFCNFSS--RPLLQS*KVSRLFNCCAHGKR 133
           + FG  P PI+  + SS  R L +S  +  L  C  +G+R
Sbjct: 381 KVFGPDPPPIILADHSSRRRSLPESTNLYELLECPCYGRR 420


>SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1822

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +3

Query: 477  YSDVRCRENYCFAEATNTSAISGERMRIQS 566
            Y DV+C+E+ C+    N   I G R+ + S
Sbjct: 1435 YHDVQCQESVCYCVNANGDEIYGTRVDMPS 1464


>SB_20396| Best HMM Match : SEC-C (HMM E-Value=1.5)
          Length = 715

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -1

Query: 246 RTFGSTPDPIVFCNFSS--RPLLQS*KVSRLFNCCAHGKR 133
           + FG  P PI+  + SS  R L +S  +  L  C  +G+R
Sbjct: 557 KVFGPDPPPIILADHSSRRRSLPESTNLYELLECPCYGRR 596


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,690,893
Number of Sequences: 59808
Number of extensions: 378466
Number of successful extensions: 1068
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 909
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1065
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1422302661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).