SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)               95   3e-20
SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)               91   4e-19
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   5e-11
SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   3e-10
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              60   1e-09
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       60   1e-09
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          60   1e-09
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           58   4e-09
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   4e-09
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   6e-09
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  54   1e-07
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   2e-07
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   3e-07
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                52   4e-07
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   1e-06
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   1e-06
SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     48   5e-06
SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   6e-06
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)                   47   1e-05
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   1e-05
SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)                    46   3e-05
SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5)                    45   3e-05
SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   1e-04
SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   2e-04
SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   7e-04
SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.002
SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68)          38   0.007
SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.007
SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.007
SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002)                     37   0.009
SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.009
SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)              37   0.009
SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.012
SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.012
SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.063
SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.083
SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.11 
SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12)         33   0.11 
SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.19 
SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)        32   0.25 
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)           32   0.25 
SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.25 
SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4)            32   0.33 
SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.44 
SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.44 
SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.44 
SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.77 
SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.77 
SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    31   0.77 
SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.77 
SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.77 
SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.77 
SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.77 
SB_3518| Best HMM Match : Ank (HMM E-Value=0.15)                       31   0.77 
SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_7769| Best HMM Match : Histone (HMM E-Value=0.2)                    30   1.0  
SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5)                      30   1.4  
SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.4  
SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                   29   1.8  
SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)                     29   1.8  
SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   1.8  
SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6)                    29   1.8  
SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08)                   29   1.8  
SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   1.8  
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_46308| Best HMM Match : IMS (HMM E-Value=0)                         29   2.4  
SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07)                   29   2.4  
SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.4  
SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.4  
SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26)                29   2.4  
SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5)                     29   2.4  
SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.4  
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3)                  29   3.1  
SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     28   4.1  
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               28   4.1  
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)                  28   4.1  
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    28   4.1  
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)           28   4.1  
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     28   4.1  
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)             28   4.1  
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          28   4.1  
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                   28   4.1  
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        28   4.1  
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)           28   4.1  
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    28   4.1  
SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    28   4.1  
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    28   4.1  
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)                       28   4.1  
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)               28   4.1  
SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                      28   4.1  
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)                28   4.1  
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)                      28   4.1  
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)               28   4.1  
SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)                28   4.1  
SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)                    28   4.1  
SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)                    28   4.1  
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46412| Best HMM Match : HEAT (HMM E-Value=8)                        28   4.1  
SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)                    28   4.1  
SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)               28   4.1  
SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)                 28   4.1  
SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074)                    28   4.1  
SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)                      28   4.1  
SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)                 28   4.1  
SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003)               28   4.1  
SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)                    28   4.1  
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)                   28   4.1  
SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)                    28   4.1  
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)                28   4.1  
SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)                 28   4.1  
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)                28   4.1  
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)                 28   4.1  
SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)               28   4.1  
SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2)             28   4.1  
SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)               28   4.1  
SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)             28   4.1  
SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78)              28   4.1  
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)             28   4.1  
SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34793| Best HMM Match : TIL (HMM E-Value=4.5)                       28   4.1  
SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3)             28   4.1  
SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                         28   4.1  
SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15)                 28   4.1  
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                 28   4.1  
SB_32525| Best HMM Match : DED (HMM E-Value=0.81)                      28   4.1  
SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)              28   4.1  
SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6)                    28   4.1  
SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31658| Best HMM Match : Arm (HMM E-Value=0.91)                      28   4.1  
SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)              28   4.1  
SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  

>SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)
          Length = 143

 Score = 95.1 bits (226), Expect = 3e-20
 Identities = 43/48 (89%), Positives = 48/48 (100%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS
Sbjct: 96  ENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143



 Score = 84.2 bits (199), Expect = 6e-17
 Identities = 37/44 (84%), Positives = 42/44 (95%)
 Frame = -2

Query: 383 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IE+
Sbjct: 53  QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEE 96


>SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)
          Length = 413

 Score = 91.5 bits (217), Expect = 4e-19
 Identities = 42/48 (87%), Positives = 45/48 (93%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IE+
Sbjct: 48  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEE 95



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 18/23 (78%), Positives = 23/23 (100%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGV 187
           +NDEVL++GFGR+GHAVGDIPG+
Sbjct: 95  ENDEVLISGFGRRGHAVGDIPGI 117


>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 64.5 bits (150), Expect = 5e-11
 Identities = 29/40 (72%), Positives = 30/40 (75%)
 Frame = -1

Query: 519 EKGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           EKGDVLQ  L  G  + FP   VVKRRPVNCNTTHYRANW
Sbjct: 63  EKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102


>SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 25/26 (96%), Positives = 25/26 (96%)
 Frame = +1

Query: 403 IRPIVSRITIHWPSFYNRRDWENPGV 480
           IRPIVSRITIHWPSFY RRDWENPGV
Sbjct: 18  IRPIVSRITIHWPSFYKRRDWENPGV 43


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/39 (71%), Positives = 28/39 (71%)
 Frame = -1

Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           KG    RRLSWG    FP   VVKRRPVNCNTTHYRANW
Sbjct: 614 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 648


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/39 (71%), Positives = 28/39 (71%)
 Frame = -1

Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           KG    RRLSWG    FP   VVKRRPVNCNTTHYRANW
Sbjct: 57  KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/39 (71%), Positives = 28/39 (71%)
 Frame = -1

Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           KG    RRLSWG    FP   VVKRRPVNCNTTHYRANW
Sbjct: 57  KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 58.0 bits (134), Expect = 4e-09
 Identities = 24/33 (72%), Positives = 26/33 (78%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           + +  GNA VFP   VVKRRPVNCNTTHYRANW
Sbjct: 21  KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 58.0 bits (134), Expect = 4e-09
 Identities = 24/33 (72%), Positives = 26/33 (78%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           + +  GNA VFP   VVKRRPVNCNTTHYRANW
Sbjct: 35  KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 57.6 bits (133), Expect = 6e-09
 Identities = 27/39 (69%), Positives = 27/39 (69%)
 Frame = -1

Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           KG    RRLSW     FP   VVKRRPVNCNTTHYRANW
Sbjct: 43  KGGCAARRLSWVTPG-FPSHDVVKRRPVNCNTTHYRANW 80


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           + +  GNA+ FP   VVKRRPVNCNTTHYRANW
Sbjct: 27  KAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 22/33 (66%), Positives = 25/33 (75%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           + +   +A VFP   VVKRRPVNCNTTHYRANW
Sbjct: 29  KSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61


>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 52.4 bits (120), Expect = 2e-07
 Identities = 22/27 (81%), Positives = 23/27 (85%)
 Frame = -1

Query: 480 NARVFPVTTVVKRRPVNCNTTHYRANW 400
           +A VFP   VVKRRPVNCNTTHYRANW
Sbjct: 33  HAIVFPSHDVVKRRPVNCNTTHYRANW 59


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 22/32 (68%), Positives = 22/32 (68%)
 Frame = -1

Query: 495 RLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400
           R  W     FP   VVKRRPVNCNTTHYRANW
Sbjct: 49  RNCWEGRSGFPSHDVVKRRPVNCNTTHYRANW 80


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = -1

Query: 471  VFPVTTVVKRRPVNCNTTHYRANW 400
            VFP   VVKRRPVNCNTTHYRANW
Sbjct: 1876 VFPSHDVVKRRPVNCNTTHYRANW 1899


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 20/23 (86%), Positives = 20/23 (86%)
 Frame = -1

Query: 468 FPVTTVVKRRPVNCNTTHYRANW 400
           FP   VVKRRPVNCNTTHYRANW
Sbjct: 2   FPSHDVVKRRPVNCNTTHYRANW 24


>SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 22/32 (68%), Positives = 24/32 (75%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRAN 403
           + +  GNA VF    VVKRRPVNCNTTHYRAN
Sbjct: 9   KAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40


>SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 19/23 (82%), Positives = 20/23 (86%)
 Frame = +1

Query: 415 VSRITIHWPSFYNRRDWENPGVT 483
           +SRITIHWPS   RRDWENPGVT
Sbjct: 277 LSRITIHWPSVLQRRDWENPGVT 299


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 21/32 (65%), Positives = 23/32 (71%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRAN 403
           + +  GNAR FP     KRRPVNCNTTHYRAN
Sbjct: 66  KAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97


>SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 47.6 bits (108), Expect = 6e-06
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVT 483
           SRITIHWPSFYN   WENPGVT
Sbjct: 2   SRITIHWPSFYNVVHWENPGVT 23


>SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)
          Length = 257

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = -1

Query: 453 VVKRRPVNCNTTHYRANW 400
           VVKRRPVNCNTTHYRANW
Sbjct: 4   VVKRRPVNCNTTHYRANW 21


>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = -1

Query: 453 VVKRRPVNCNTTHYRANW 400
           VVKRRPVNCNTTHYRANW
Sbjct: 4   VVKRRPVNCNTTHYRANW 21


>SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)
          Length = 142

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +1

Query: 391 GPVPIRPIVSRITIHWPSFYN 453
           G  PIRPIVSRITIHWP+FYN
Sbjct: 36  GGAPIRPIVSRITIHWPAFYN 56



 Score = 30.3 bits (65), Expect = 1.0
 Identities = 14/25 (56%), Positives = 16/25 (64%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F    TGKTLA  QLNRL +  PF+
Sbjct: 54  FYNAPTGKTLAYTQLNRLAAHPPFA 78


>SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5)
          Length = 131

 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 283 GTNAVTFFPFLMS-CTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN 453
           GT A T  P  +    +  +   + G   S+   +  G  PIRPIVS ITIHWPSFYN
Sbjct: 1   GTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATVGGAPIRPIVSHITIHWPSFYN 58


>SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 20/33 (60%), Positives = 23/33 (69%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516
           SRITIHWPSFYN    +N G  P+   LQ+IPL
Sbjct: 2   SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPL 34


>SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 21/38 (55%), Positives = 25/38 (65%)
 Frame = +1

Query: 403 IRPIVSRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516
           +RP+VSRITIHW SFYN    +   + P    LQHIPL
Sbjct: 33  LRPVVSRITIHWTSFYNVVTGKTLAL-PNLIALQHIPL 69


>SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 17/22 (77%), Positives = 18/22 (81%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVT 483
           SRITIHWPSFYN    +NPGVT
Sbjct: 2   SRITIHWPSFYNVVTGKNPGVT 23



 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGK   + QLNRL +  PF+
Sbjct: 11  FYNVVTGKNPGVTQLNRLAAHPPFA 35


>SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/36 (55%), Positives = 23/36 (63%)
 Frame = +1

Query: 409 PIVSRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516
           P +SRITIHWPSFYN    +   + P    LQHIPL
Sbjct: 77  PYMSRITIHWPSFYNVVTGKTLAL-PNLIALQHIPL 111


>SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +2

Query: 431 FTGRRFTTVVTGKTLALPQL 490
           +TGRRFTT+VTGKTLALP L
Sbjct: 54  WTGRRFTTLVTGKTLALPNL 73


>SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68)
          Length = 282

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +1

Query: 364 ASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVTPT*SPLQHIP 513
           A++ +F     V I+ I+      WPS YN RDW N GVT     + H+P
Sbjct: 195 AASTSFLANREVNIQDIMKSAGC-WPSIYNDRDWNNSGVTQLNRLVAHLP 243


>SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVT 483
           SRITIHWPSFYN    +N GVT
Sbjct: 2   SRITIHWPSFYNVVTGKNTGVT 23



 Score = 29.5 bits (63), Expect = 1.8
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGK   + QLNRL +  PF+
Sbjct: 11  FYNVVTGKNTGVTQLNRLAAHPPFA 35


>SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVT 483
           SRITIHWPSFYN    + PGVT
Sbjct: 2   SRITIHWPSFYNVMLAKTPGVT 23


>SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVT 483
           SRITIHWPSFYN    +N GVT
Sbjct: 2   SRITIHWPSFYNVVTGKNTGVT 23



 Score = 29.5 bits (63), Expect = 1.8
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGK   + QLNRL +  PF+
Sbjct: 11  FYNVVTGKNTGVTQLNRLAAHPPFA 35


>SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002)
          Length = 428

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 10/68 (14%)
 Frame = +1

Query: 310 FLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RR 459
           F   C R   RM  + C   + + S G P+ +     R + + P   S+YN       RR
Sbjct: 141 FYKGCHRCECRMEGINCEVGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRR 200

Query: 460 DWENPGVT 483
           DWENPGVT
Sbjct: 201 DWENPGVT 208


>SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 19/33 (57%), Positives = 21/33 (63%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516
           SRITIHWPSFYN    +   + P    LQHIPL
Sbjct: 2   SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPL 33


>SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)
          Length = 98

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 19/33 (57%), Positives = 21/33 (63%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516
           SRITIHWPSFYN    +   + P    LQHIPL
Sbjct: 2   SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPL 33


>SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 36.7 bits (81), Expect = 0.012
 Identities = 19/34 (55%), Positives = 21/34 (61%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPLF 519
           SRITIHWPSFYN    +   + P    LQHIP F
Sbjct: 2   SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPPF 34



 Score = 29.9 bits (64), Expect = 1.4
 Identities = 15/25 (60%), Positives = 16/25 (64%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGKTLALP L  L    PF+
Sbjct: 11  FYNVVTGKTLALPNLIALQHIPPFA 35


>SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 36.7 bits (81), Expect = 0.012
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +1

Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPLF 519
           SRITIHWPSFYN    +   + P    L+HIPL+
Sbjct: 2   SRITIHWPSFYNVVTGKTLAL-PNLFDLRHIPLY 34


>SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +2

Query: 434 TGRRFTTVVTGKTLALPQLNRL 499
           TGRR   VVTGKTLA+P LN L
Sbjct: 8   TGRRVYDVVTGKTLAVPSLNAL 29


>SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGKTL++ QLNRL +  PF+
Sbjct: 11  FYNVVTGKTLSVTQLNRLAAHPPFA 35



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 418 SRITIHWPSFYN 453
           SRITIHWPSFYN
Sbjct: 2   SRITIHWPSFYN 13


>SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGKTL + QLNRL +  PF+
Sbjct: 9   FYNVVTGKTLGVTQLNRLAAHPPFA 33


>SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12)
          Length = 302

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 14/27 (51%), Positives = 21/27 (77%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVP 282
           K+PNSA RKC  ++L  NGK ++A++P
Sbjct: 242 KKPNSAQRKCALLKL-SNGKTISAYIP 267


>SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 418 SRITIHWPSFYN 453
           SRITIHWPSFYN
Sbjct: 2   SRITIHWPSFYN 13



 Score = 31.5 bits (68), Expect = 0.44
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGKTLALP L  L +  PF+
Sbjct: 11  FYNVVTGKTLALPNLIALAAHPPFA 35


>SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 418 SRITIHWPSFYN 453
           SRITIHWPSFYN
Sbjct: 2   SRITIHWPSFYN 13



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 15/25 (60%), Positives = 16/25 (64%)
 Frame = +2

Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520
           F  VVTGKTLALP L  L    PF+
Sbjct: 11  FYNVVTGKTLALPNLIALQLHPPFA 35


>SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)
          Length = 1709

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 7/25 (28%)
 Frame = +1

Query: 430  IHWPSFYN-------RRDWENPGVT 483
            IH+ S+YN       RRDWENPGVT
Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVT 1488


>SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)
          Length = 207

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 7/72 (9%)
 Frame = +1

Query: 289 NAVTFFPF-------LMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSF 447
           N V+F+PF       L+  T  HLR   L  +   P     G  P+       ++     
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRY-RLTDVPPQPNSQPDGD-PLESTCRHASLALAVV 129

Query: 448 YNRRDWENPGVT 483
             RRDWENPGVT
Sbjct: 130 LQRRDWENPGVT 141


>SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 319

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 10/60 (16%)
 Frame = +1

Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           H +  E+  L S+     G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 152 HFKSYEINSLRSSKPIDPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 211


>SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4)
          Length = 152

 Score = 31.9 bits (69), Expect = 0.33
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 7/32 (21%)
 Frame = +1

Query: 409 PIVSRITIHWPSFYN-------RRDWENPGVT 483
           P V + + H  S+YN       RRDWENPGVT
Sbjct: 46  PFVPKSSRHSESYYNSLAVVLQRRDWENPGVT 77


>SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 1/69 (1%)
 Frame = +1

Query: 283 GTNAVTFFPFLMS-CTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRR 459
           GT A T  P  +    +  +   + G   S+   +  G  PIRP              R 
Sbjct: 14  GTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATAGGAPIRPYSESYYSSLAVGLQRL 73

Query: 460 DWENPGVTP 486
           DW+NPGVTP
Sbjct: 74  DWKNPGVTP 82


>SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 227

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 10/47 (21%)
 Frame = +1

Query: 373 PTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           P F  GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 106 PIFKPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 152


>SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 14/22 (63%), Positives = 16/22 (72%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPV 433
           + +  GNARVFP   VVKRRPV
Sbjct: 4   KAIKLGNARVFPSHDVVKRRPV 25


>SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 17/28 (60%), Positives = 17/28 (60%)
 Frame = -1

Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPV 433
           KG    RRLSWG    FP   VVKRRPV
Sbjct: 44  KGGCAARRLSWG----FPSHDVVKRRPV 67


>SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%)
 Frame = +1

Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           L   E GC       S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 69  LYACEAGCQYEPVELSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 127


>SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 14/43 (32%), Positives = 19/43 (44%)
 Frame = +1

Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           G + S  +F      P+       ++       RRDWENPGVT
Sbjct: 80  GIVVSRSSFGMASGDPLESTCRHASLALAVVLQRRDWENPGVT 122


>SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 24/66 (36%), Positives = 28/66 (42%), Gaps = 7/66 (10%)
 Frame = +1

Query: 307 PFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN-------RRDW 465
           P L  CT  HL  +   C    P      P    P  S  + +  S+YN       RRDW
Sbjct: 43  PLLSPCTPPHLSPSN-SCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAVVLQRRDW 97

Query: 466 ENPGVT 483
           ENPGVT
Sbjct: 98  ENPGVT 103


>SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 12/71 (16%)
 Frame = +1

Query: 307 PFLMSCTRTHLRMAEL--GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN------ 453
           P +   T  HL  A L  G   ++ + S G P+ +     R + + P   S+YN      
Sbjct: 31  PKVSDSTHVHLEPAFLAEGFRVASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVL 90

Query: 454 -RRDWENPGVT 483
            RRDWENPGVT
Sbjct: 91  QRRDWENPGVT 101


>SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 10/62 (16%)
 Frame = +1

Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPG 477
           R   R+A L C + + + S G P+ +     R + + P   S+YN       RRDWENPG
Sbjct: 17  RQRTRVASL-CRSRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 75

Query: 478 VT 483
           VT
Sbjct: 76  VT 77


>SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9)
          Length = 137

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 10/61 (16%)
 Frame = +1

Query: 331 THLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGV 480
           +H+    +  L S+ + S G P+ +     R + + P   S+YN       RRDWENPGV
Sbjct: 2   SHMTYVTIHVLNSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 61

Query: 481 T 483
           T
Sbjct: 62  T 62


>SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%)
 Frame = +1

Query: 346 AELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           AE+  ++S      GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 55  AEIAEISSIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 110


>SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 17/45 (37%), Positives = 20/45 (44%)
 Frame = +1

Query: 349 ELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           ELG        SR G  P+       ++       RRDWENPGVT
Sbjct: 27  ELGTQCVAAHSSRSGD-PLESTCRHASLALAVVLQRRDWENPGVT 70


>SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 10/52 (19%)
 Frame = +1

Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           C +S+ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 3   CASSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 54


>SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 10/42 (23%)
 Frame = +1

Query: 388 GGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           GG    R +V+ + +    + S+YN       RRDWENPGVT
Sbjct: 15  GGSTSSRAVVTAVELQFALYESYYNSLAVVLQRRDWENPGVT 56


>SB_3518| Best HMM Match : Ank (HMM E-Value=0.15)
          Length = 159

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 16/72 (22%)
 Frame = +1

Query: 316 MSCTRTHLRMAEL--GCLAST----PTFSRGGPVPIRPIVSRITIHWP---SFYN----- 453
           ++C   H+ +  L   C AS     P  S G P+ +     R + + P   S+YN     
Sbjct: 13  IACRENHVEVVRLLLDCGASVNAPFPNSSPGDPLVLERPPPRWSSNSPYSESYYNSLAVV 72

Query: 454 --RRDWENPGVT 483
             RRDWENPGVT
Sbjct: 73  LQRRDWENPGVT 84


>SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = +1

Query: 445 FYNRRDWENPGVT 483
           F  RRDWENPGVT
Sbjct: 19  FLQRRDWENPGVT 31


>SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 5/57 (8%)
 Frame = +1

Query: 328 RTHLRMAELGCLASTPTFSRGGPV-----PIRPIVSRITIHWPSFYNRRDWENPGVT 483
           + H    E G   S P   R  P+     P+       ++       RRDWENPGVT
Sbjct: 3   KRHASRREKGGQVSEPNLLREIPILLPGDPLESTCRHASLALAVVLQRRDWENPGVT 59


>SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 214

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 10/52 (19%)
 Frame = +1

Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           C+ ++ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 87  CIVTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 138


>SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = +1

Query: 445 FYNRRDWENPGVT 483
           F  RRDWENPGVT
Sbjct: 68  FLQRRDWENPGVT 80


>SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = +1

Query: 445 FYNRRDWENPGVT 483
           F  RRDWENPGVT
Sbjct: 11  FLQRRDWENPGVT 23


>SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 3/28 (10%)
 Frame = +1

Query: 409 PIVSRITIHWPSF---YNRRDWENPGVT 483
           P++ R+  ++ S      RRDWENPGVT
Sbjct: 50  PVMGRLESYYNSLAVVLQRRDWENPGVT 77


>SB_7769| Best HMM Match : Histone (HMM E-Value=0.2)
          Length = 150

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +1

Query: 349 ELGCLASTPTFSRGGPV-PIRPIVSRITIHWPSFYNRRDWENPGVT 483
           EL  L    T ++GG   P+       ++       RRDWENPGVT
Sbjct: 39  ELNRLLHGVTIAQGGVGDPLESTCRHASLALAVVLQRRDWENPGVT 84


>SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5)
          Length = 186

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 10/53 (18%)
 Frame = +1

Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           G L+ + + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 58  GALSQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 110


>SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 10/59 (16%)
 Frame = +1

Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           L    L CL S  + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 6   LSFLPLPCLRSN-SCSPGDPLVLERAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 63


>SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 448 YNRRDWENPGVT 483
           + RRDWENPGVT
Sbjct: 44  FTRRDWENPGVT 55


>SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)
          Length = 157

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 7/74 (9%)
 Frame = +1

Query: 283 GTNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN--- 453
           G N +  F  L++ + +         L + P  S         +  +  ++  S+YN   
Sbjct: 10  GINIIAIFTALVTASVSASTRPYFNILGAKPGGSTSSRAAATAVELQFALY-ESYYNSLA 68

Query: 454 ----RRDWENPGVT 483
               RRDWENPGVT
Sbjct: 69  VVLQRRDWENPGVT 82


>SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)
          Length = 181

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +1

Query: 385 RGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           RGG  P+       ++       RRDWENPGVT
Sbjct: 84  RGGD-PLESTCRHASLALAVVLQRRDWENPGVT 115


>SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = +1

Query: 373 PTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           PT    G  P+       ++       RRDWENPGVT
Sbjct: 39  PTIKASGD-PLESTCRHASLALAVVLQRRDWENPGVT 74


>SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%)
 Frame = +1

Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           +R  +  C   + + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 46  MRSPDAHCRVPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 104


>SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 18/46 (39%), Positives = 21/46 (45%)
 Frame = +1

Query: 346 AELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           AE G L     F RG P  +       ++       RRDWENPGVT
Sbjct: 38  AEQGRL-DVEAFGRGDP--LESTCRHASLALAVVLQRRDWENPGVT 80


>SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -2

Query: 428 VIRLTIG-RIGTGPPLEKVGVEAKQPNSAIRK 336
           +I   IG + GTGPPLE  G++   P +A  K
Sbjct: 8   LISANIGTKAGTGPPLEVDGIDKLDPEAAFEK 39



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 110 RRDWENPGVT 119


>SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 10/62 (16%)
 Frame = +1

Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPG 477
           + H R      +A++ + S G P+ +     R + + P   S+YN       RRDWENPG
Sbjct: 67  KVHCRKQRSREVATSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 126

Query: 478 VT 483
           VT
Sbjct: 127 VT 128


>SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 85

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 4/41 (9%)
 Frame = +1

Query: 373 PTFSRGGPVPIR-PIVS---RITIHWPSFYNRRDWENPGVT 483
           PTF+    +PI  P+ S     ++       RRDWENPGVT
Sbjct: 5   PTFADNDTLPIGDPLESTCRHASLALAVVLQRRDWENPGVT 45


>SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6)
          Length = 175

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 10/53 (18%)
 Frame = +1

Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           G  AS+ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 47  GGTASSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 99


>SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 13/15 (86%), Positives = 13/15 (86%)
 Frame = -1

Query: 528 SWPEKGDVLQRRLSW 484
           SW  KGDVLQRRLSW
Sbjct: 19  SW-RKGDVLQRRLSW 32


>SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 13/23 (56%), Positives = 13/23 (56%)
 Frame = +1

Query: 454 RRDWENPGVTPT*SPLQHIPLFR 522
           RRDWENPGVT       H P  R
Sbjct: 71  RRDWENPGVTQLNRLAAHPPFAR 93


>SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 10/52 (19%)
 Frame = +1

Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           C+ ++ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 2   CIFASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 53


>SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08)
          Length = 215

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 13/23 (56%), Positives = 13/23 (56%)
 Frame = +1

Query: 454 RRDWENPGVTPT*SPLQHIPLFR 522
           RRDWENPGVT       H P  R
Sbjct: 71  RRDWENPGVTQLNRLAAHPPFAR 93


>SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%)
 Frame = +1

Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           LG L  + + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 22  LGSLIISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 75


>SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +1

Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           FS+    P+       ++       RRDWENPGVT
Sbjct: 1   FSKVSGDPLESTCRHASLALAVVLQRRDWENPGVT 35


>SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +1

Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           F+  G  P+       ++       RRDWENPGVT
Sbjct: 38  FAGEGGDPLESTCRHASLALAVVLQRRDWENPGVT 72


>SB_46308| Best HMM Match : IMS (HMM E-Value=0)
          Length = 1245

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = +1

Query: 382  SRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
            S+G   P+       ++       RRDWENPGVT
Sbjct: 1172 SQGKGDPLESTCRHASLALAVVLQRRDWENPGVT 1205


>SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = +1

Query: 433 HWPSFYNRRDWENPGVTPT*SPLQHIPLF 519
           HWPSFYN    +   + P    LQHIP F
Sbjct: 5   HWPSFYNDVTGKTLAL-PNLIALQHIPTF 32


>SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 447

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 10/53 (18%)
 Frame = +1

Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           G L ++ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 75  GILLTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 127


>SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 293

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 10/69 (14%)
 Frame = +1

Query: 307 PFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------R 456
           P   S    H+ +    C  S  T S G P+ +     R + + P   S+YN       R
Sbjct: 150 PHYASTAHAHMHLPWPLCPYSGST-SPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQR 208

Query: 457 RDWENPGVT 483
           RDWENPGVT
Sbjct: 209 RDWENPGVT 217


>SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07)
          Length = 183

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/40 (35%), Positives = 19/40 (47%)
 Frame = +1

Query: 364 ASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           A     ++GG  P+       ++       RRDWENPGVT
Sbjct: 79  AHAADLAKGGD-PLESTCRHASLALAVVLQRRDWENPGVT 117


>SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 211

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 14/38 (36%), Positives = 18/38 (47%)
 Frame = +1

Query: 370 TPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           TP  +R    P+       ++       RRDWENPGVT
Sbjct: 134 TPQENRYEGDPLESTCRHASLALAVVLQRRDWENPGVT 171


>SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 10/64 (15%)
 Frame = +1

Query: 322 CTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWEN 471
           C + +L +  L C         GG    R   + + +    + S+YN       RRDWEN
Sbjct: 22  CCKVYLNVNVL-CPVLIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWEN 80

Query: 472 PGVT 483
           PGVT
Sbjct: 81  PGVT 84


>SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26)
          Length = 1064

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 22/66 (33%), Positives = 27/66 (40%)
 Frame = +1

Query: 286 TNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDW 465
           TN+     F++S    H  MA    L  T T      VP        ++       RRDW
Sbjct: 747 TNSCWETDFVISIDAKHDNMAFSRSLPFTVT------VPSESTCRHASLALAVVLQRRDW 800

Query: 466 ENPGVT 483
           ENPGVT
Sbjct: 801 ENPGVT 806


>SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 455 VVTGKTLALPQLNRLCSTSPFS 520
           VVTGKT  + QLNRL +  PF+
Sbjct: 14  VVTGKTPGVTQLNRLAAHPPFA 35


>SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 7/59 (11%)
 Frame = +1

Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN-------RRDWENPGVT 483
           R H+  A   C    P      P    P  S  + +  S+YN       RRDWENPGVT
Sbjct: 8   RPHIHRASNSCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 62


>SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 10/58 (17%)
 Frame = +1

Query: 340 RMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           R+ +L  L        GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 15  RLPKLDALRWIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 72


>SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 10/51 (19%)
 Frame = +1

Query: 361 LASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           L+S+ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 12  LSSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 62


>SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 44

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = -1

Query: 498 RRLSWGNARVFPVTTVVKRRPV 433
           + +  GNA VFP   VVKRRPV
Sbjct: 4   KAIKLGNASVFPSHDVVKRRPV 25


>SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 10/59 (16%)
 Frame = +1

Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           L + + GCL        GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 17  LTVGKKGCLIEF--LQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 73


>SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%)
 Frame = +1

Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           L C A + + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 3   LFCEAVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 56


>SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 10/53 (18%)
 Frame = +1

Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           G  A++ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 17  GICAASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 69


>SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5)
          Length = 144

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 18/45 (40%), Positives = 21/45 (46%)
 Frame = +1

Query: 349 ELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           ELG LA       GG  P+       ++       RRDWENPGVT
Sbjct: 27  ELGTLA-LHRLDVGGD-PLESTCRHASLALAVVLQRRDWENPGVT 69


>SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 7/73 (9%)
 Frame = +1

Query: 286 TNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN---- 453
           T  VT   F+ + +   +  A   C    P      P    P  S  + +  S+YN    
Sbjct: 13  TRRVTVITFVHTTSYLTIHSASNSCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAV 68

Query: 454 ---RRDWENPGVT 483
              RRDWENPGVT
Sbjct: 69  VLQRRDWENPGVT 81


>SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 10/52 (19%)
 Frame = +1

Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           C  ++ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 7   CYKTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 58


>SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 14/34 (41%), Positives = 17/34 (50%)
 Frame = +1

Query: 382 SRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           SR G  P+       ++       RRDWENPGVT
Sbjct: 11  SRNGD-PLESTCRHASLALAVVLQRRDWENPGVT 43


>SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 15/39 (38%), Positives = 19/39 (48%)
 Frame = +1

Query: 367 STPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           S PT +  G  P+       ++       RRDWENPGVT
Sbjct: 2   SPPTPTATGD-PLESTCRHASLALAVVLQRRDWENPGVT 39


>SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           LG  ++ P    G P  +       ++       RRDWENPGVT
Sbjct: 32  LGICSAGPIQKEGDP--LESTCRHASLALAVVLQRRDWENPGVT 73


>SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 23/74 (31%), Positives = 29/74 (39%), Gaps = 15/74 (20%)
 Frame = +1

Query: 307 PFLMSCTRTHL--RMAELGC---LASTPTFSRGGPVPIRPIVSRITIH---WPSFYN--- 453
           P   SC   HL  R     C   +        GG    R   + + +    + S+YN   
Sbjct: 19  PITKSCCHGHLYIRATHACCHDKVVKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLA 78

Query: 454 ----RRDWENPGVT 483
               RRDWENPGVT
Sbjct: 79  VVLQRRDWENPGVT 92


>SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 446

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 10/45 (22%)
 Frame = +1

Query: 379 FSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           FS G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 326 FSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 370


>SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 207

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +1

Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           F R    P+       ++       RRDWENPGVT
Sbjct: 107 FQRDQGDPLESTCRHASLALAVVLQRRDWENPGVT 141


>SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 15/26 (57%), Positives = 16/26 (61%), Gaps = 7/26 (26%)
 Frame = +1

Query: 427 TIHWPSFYN-------RRDWENPGVT 483
           TI   S+YN       RRDWENPGVT
Sbjct: 55  TIRPESYYNSLAVVLQRRDWENPGVT 80


>SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 10/51 (19%)
 Frame = +1

Query: 361 LASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           L+S      GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 48  LSSIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 98


>SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3)
          Length = 292

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +1

Query: 382 SRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           ++GG  P+       ++       RRDWENPGVT
Sbjct: 36  AKGGD-PLESTCRHASLALAVVLQRRDWENPGVT 68


>SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 10/52 (19%)
 Frame = +1

Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           C+  + + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 3   CMLVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 54


>SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 10/54 (18%)
 Frame = +1

Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           +G + ++ + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 1   MGTVQASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 54


>SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +1

Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN-------RRDWENPGVT 483
           HL+ A   C    P      P    P  S  + +  S+YN       RRDWENPGVT
Sbjct: 22  HLQAASNSCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 74


>SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 10/65 (15%)
 Frame = +1

Query: 319 SCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWE 468
           SC   HLR   L    ++ + S G P+ +     R + + P   S+YN       RRDWE
Sbjct: 50  SCEVIHLR--SLYFPETSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWE 107

Query: 469 NPGVT 483
           NPGVT
Sbjct: 108 NPGVT 112


>SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +1

Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           F R    P+       ++       RRDWENPGVT
Sbjct: 18  FHRSTGDPLESTCRHASLALAVVLQRRDWENPGVT 52


>SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 463

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 10/60 (16%)
 Frame = +1

Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           H  M E+   +       GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 186 HGTMKEVRWTSGIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 245


>SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 10/51 (19%)
 Frame = +1

Query: 361 LASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           LA + + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 14  LAGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 64


>SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 10/62 (16%)
 Frame = +1

Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPG 477
           R  +R+    C   + + S G P+ +     R + + P   S+YN       RRDWENPG
Sbjct: 18  RLRVRLRYRICRERSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 77

Query: 478 VT 483
           VT
Sbjct: 78  VT 79


>SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%)
 Frame = +1

Query: 322 CTRTHLRMAELGCLASTPTFSRGG-PVPIRPIVSRITIHWPSFYNRRDWENPGVT 483
           CT  + R  + G   S+ T S      P+       ++       RRDWENPGVT
Sbjct: 5   CTLKYWRSRKPGNTNSSTTASSAVIGDPLESTCRHASLALAVVLQRRDWENPGVT 59


>SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 10/57 (17%)
 Frame = +1

Query: 343 MAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483
           ++ +  L S      GG    R   + + +    + S+YN       RRDWENPGVT
Sbjct: 49  LSPVAILISIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 105


>SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 10/60 (16%)
 Frame = +1

Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           H+  +   C +S  + S G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 19  HIIKSRCSCQSSN-SCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 77


>SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 10/45 (22%)
 Frame = +1

Query: 379 FSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483
           FS G P+ +     R + + P   S+YN       RRDWENPGVT
Sbjct: 48  FSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 92


>SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 41  RRDWENPGVT 50


>SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 21  RRDWENPGVT 30


>SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 68  RRDWENPGVT 77


>SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 50  RRDWENPGVT 59


>SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 42  RRDWENPGVT 51


>SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 68  RRDWENPGVT 77


>SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 73  RRDWENPGVT 82


>SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 44  RRDWENPGVT 53


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 64  RRDWENPGVT 73


>SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 76  RRDWENPGVT 85


>SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 52  RRDWENPGVT 61


>SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 41  RRDWENPGVT 50


>SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 31  RRDWENPGVT 40


>SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 56  RRDWENPGVT 65


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 65  RRDWENPGVT 74


>SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 59  RRDWENPGVT 68


>SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 75  RRDWENPGVT 84


>SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 63  RRDWENPGVT 72


>SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 46  RRDWENPGVT 55


>SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)
          Length = 297

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 222 RRDWENPGVT 231


>SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 117 RRDWENPGVT 126


>SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 55  RRDWENPGVT 64


>SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 34  RRDWENPGVT 43


>SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 22  RRDWENPGVT 31


>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 53  RRDWENPGVT 62


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 387 RRDWENPGVT 396


>SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)
          Length = 198

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 113 RRDWENPGVT 122


>SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 89  RRDWENPGVT 98


>SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 45  RRDWENPGVT 54


>SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 14  RRDWENPGVT 23


>SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 24  RRDWENPGVT 33


>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
          Length = 129

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 44  RRDWENPGVT 53


>SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 109 RRDWENPGVT 118


>SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 51  RRDWENPGVT 60


>SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 346 RRDWENPGVT 355


>SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 86  RRDWENPGVT 95


>SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 56  RRDWENPGVT 65


>SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 22  RRDWENPGVT 31


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 65  RRDWENPGVT 74


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 140 RRDWENPGVT 149


>SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 69  RRDWENPGVT 78


>SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 45  RRDWENPGVT 54


>SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)
          Length = 295

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 149 RRDWENPGVT 158


>SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 917

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 839 RRDWENPGVT 848


>SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 22  RRDWENPGVT 31


>SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 66  RRDWENPGVT 75


>SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 40  RRDWENPGVT 49


>SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 79  RRDWENPGVT 88


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 73  RRDWENPGVT 82


>SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 62  RRDWENPGVT 71


>SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 75  RRDWENPGVT 84


>SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 262 RRDWENPGVT 271


>SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)
          Length = 195

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 120 RRDWENPGVT 129


>SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 56  RRDWENPGVT 65


>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 42  RRDWENPGVT 51


>SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 43  RRDWENPGVT 52


>SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)
          Length = 192

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 107 RRDWENPGVT 116


>SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 120 RRDWENPGVT 129


>SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 45  RRDWENPGVT 54


>SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 64  RRDWENPGVT 73


>SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 43  RRDWENPGVT 52


>SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 40  RRDWENPGVT 49


>SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)
          Length = 349

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 17  RRDWENPGVT 26


>SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 25  RRDWENPGVT 34


>SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 487

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 402 RRDWENPGVT 411


>SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 51  RRDWENPGVT 60


>SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 60  RRDWENPGVT 69


>SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 42  RRDWENPGVT 51


>SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 125 RRDWENPGVT 134


>SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 61  RRDWENPGVT 70


>SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 71  RRDWENPGVT 80


>SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 74  RRDWENPGVT 83


>SB_54473| Best HMM Match : DLIC (HMM E-Value=0)
          Length = 1401

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 420 RRDWENPGVT 429


>SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)
          Length = 174

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 117 RRDWENPGVT 126


>SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 62  RRDWENPGVT 71


>SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)
          Length = 137

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 52  RRDWENPGVT 61


>SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)
          Length = 140

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 55  RRDWENPGVT 64


>SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 167 RRDWENPGVT 176


>SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 71  RRDWENPGVT 80


>SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 58  RRDWENPGVT 67


>SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 94  RRDWENPGVT 103


>SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 43  RRDWENPGVT 52


>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 69  RRDWENPGVT 78


>SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 48  RRDWENPGVT 57


>SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 300

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 191 RRDWENPGVT 200


>SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 40  RRDWENPGVT 49


>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 46  RRDWENPGVT 55


>SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 60  RRDWENPGVT 69


>SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)
          Length = 142

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 57  RRDWENPGVT 66


>SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 40  RRDWENPGVT 49


>SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 41  RRDWENPGVT 50


>SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 55  RRDWENPGVT 64


>SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 45  RRDWENPGVT 54


>SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 138 RRDWENPGVT 147


>SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 47  RRDWENPGVT 56


>SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 90  RRDWENPGVT 99


>SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 28  RRDWENPGVT 37


>SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 35  RRDWENPGVT 44


>SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)
          Length = 234

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 159 RRDWENPGVT 168


>SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
          Length = 473

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 346 RRDWENPGVT 355


>SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 63  RRDWENPGVT 72


>SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 454 RRDWENPGVT 483
           RRDWENPGVT
Sbjct: 27  RRDWENPGVT 36


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,951,382
Number of Sequences: 59808
Number of extensions: 368327
Number of successful extensions: 3928
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 3602
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3908
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1191330434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).