SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37867| Best HMM Match : PH (HMM E-Value=0.0027)                     83   6e-17
SB_10947| Best HMM Match : PH (HMM E-Value=1.3e-11)                    48   2e-06
SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086)              38   0.003
SB_939| Best HMM Match : PH (HMM E-Value=6.9e-14)                      38   0.004
SB_25419| Best HMM Match : PH (HMM E-Value=2.8e-16)                    37   0.005
SB_37277| Best HMM Match : Oxysterol_BP (HMM E-Value=0)                34   0.047
SB_21102| Best HMM Match : SH2 (HMM E-Value=6.7)                       33   0.062
SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23)                     32   0.19 
SB_15540| Best HMM Match : DUF29 (HMM E-Value=1.3)                     32   0.19 
SB_55241| Best HMM Match : PH (HMM E-Value=6.1e-12)                    31   0.44 
SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.44 
SB_41533| Best HMM Match : SH2 (HMM E-Value=6.3e-25)                   29   1.0  
SB_30782| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.0  
SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   2.3  
SB_42254| Best HMM Match : PH (HMM E-Value=5.5e-19)                    28   3.1  
SB_37831| Best HMM Match : MAM (HMM E-Value=0)                         27   5.4  
SB_36954| Best HMM Match : PH (HMM E-Value=1.2e-22)                    27   7.2  
SB_28135| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_891| Best HMM Match : DUF1098 (HMM E-Value=0.47)                    27   7.2  
SB_39788| Best HMM Match : Ricin_B_lectin (HMM E-Value=6.4e-14)        26   9.5  

>SB_37867| Best HMM Match : PH (HMM E-Value=0.0027)
          Length = 369

 Score = 83.4 bits (197), Expect = 6e-17
 Identities = 37/70 (52%), Positives = 47/70 (67%)
 Frame = -3

Query: 292 TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           +V  E   +Q   G+L+KRG L K WK RWFVLD+ ++QLRYY+  +D HC GFIDL E+
Sbjct: 201 SVKSEAPNKQLHCGYLHKRGHLFKQWKSRWFVLDTQRNQLRYYETRDDPHCAGFIDLGEM 260

Query: 112 IAVTQATPAP 83
           IAV    P P
Sbjct: 261 IAVVPGNPLP 270


>SB_10947| Best HMM Match : PH (HMM E-Value=1.3e-11)
          Length = 591

 Score = 48.4 bits (110), Expect = 2e-06
 Identities = 27/68 (39%), Positives = 34/68 (50%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFFD 44
           K WK+RWFVLD  K  L Y++  +  H KG I    ++ V +     G  KKC     F 
Sbjct: 499 KNWKKRWFVLDFTKKYLAYFETEKTQHPKGAISYQSILEVYEHRKT-GRRKKC----LFC 553

Query: 43  LRTSRRTY 20
           L T  RTY
Sbjct: 554 LDTPNRTY 561


>SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086)
          Length = 724

 Score = 37.9 bits (84), Expect = 0.003
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 4/63 (6%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD---AMEDSHCKGFID-LAEVIAVTQATPA 86
           G+L K+GA++K WK+R+F LD +K    YY+   A  D+  + +I  L   I   +   A
Sbjct: 577 GYLVKKGAVVKNWKKRYFKLDLVK--FSYYEKDTAYTDADMQSWIKALHSAIKSIRGRTA 634

Query: 85  PGP 77
            GP
Sbjct: 635 SGP 637


>SB_939| Best HMM Match : PH (HMM E-Value=6.9e-14)
          Length = 1030

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -3

Query: 343 MHDSVGTATVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIK 182
           + DS G   V  +    T +  ++ +Q   G+L K G  +K WK+RWFVL   K
Sbjct: 614 LEDS-GNTKVLKTCATYTTVSLKKGDQRKEGYLTKLGGRIKNWKKRWFVLQDGK 666


>SB_25419| Best HMM Match : PH (HMM E-Value=2.8e-16)
          Length = 453

 Score = 37.1 bits (82), Expect = 0.005
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = -3

Query: 256 RGHLYKRGALL-KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           +G+L K G  + K WK+RWFV D  +  L Y+        KG I    +  V  A+    
Sbjct: 348 KGYLTKMGGKIRKTWKKRWFVFDRQRKALLYFHDEHKKDPKGIIYFQAIEDVYAASWCSN 407

Query: 79  PPKKCDDRSFFDLRTSRRTYNFCA 8
             K    R+ F ++T +++Y   A
Sbjct: 408 --KGPSPRTTFCVKTPQKSYFIAA 429


>SB_37277| Best HMM Match : Oxysterol_BP (HMM E-Value=0)
          Length = 926

 Score = 33.9 bits (74), Expect = 0.047
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLAEVIAVTQ 98
           RG L K    +KG+++RWFVL +    L YY +  E +H C+G I+LA     T+
Sbjct: 317 RGWLLKWTNYIKGYQRRWFVLSN--GLLSYYRNQAEMAHTCRGTINLAGAFIDTE 369


>SB_21102| Best HMM Match : SH2 (HMM E-Value=6.7)
          Length = 261

 Score = 33.5 bits (73), Expect = 0.062
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           +N  G     G +   W+ RWFVL  IK++LRYY
Sbjct: 197 KNRAGQSPTEGHIQSNWRTRWFVL--IKNELRYY 228


>SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23)
          Length = 998

 Score = 31.9 bits (69), Expect = 0.19
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G+L K+G L +G+++RWFVL   K  L YY
Sbjct: 294 GYLNKKGELNRGYQRRWFVL---KGNLLYY 320


>SB_15540| Best HMM Match : DUF29 (HMM E-Value=1.3)
          Length = 150

 Score = 31.9 bits (69), Expect = 0.19
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G+L K+G ++K  K RWFVL +    L Y+     S  KG I
Sbjct: 103 QGYLIKKGHMVKSMKDRWFVLKA--GHLSYFTNRSCSEKKGEI 143


>SB_55241| Best HMM Match : PH (HMM E-Value=6.1e-12)
          Length = 734

 Score = 30.7 bits (66), Expect = 0.44
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           R  +  G+L K+G  +K WK+R+ VL +    L YY  M ++   G   L
Sbjct: 646 RHPDCHGYLSKQGHKVKSWKRRYCVLKN--GYLYYYSDMANNTALGVAKL 693


>SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 834

 Score = 30.7 bits (66), Expect = 0.44
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = -3

Query: 154 EDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYNFCASR 2
           +D+ C+   D   +I    ATP P    +C      D     RTY FCA R
Sbjct: 704 DDTMCRS--DKTPLIGDCDATPVPLTSSECPRPFSADSNDRGRTYGFCAER 752


>SB_41533| Best HMM Match : SH2 (HMM E-Value=6.3e-25)
          Length = 389

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 13/49 (26%), Positives = 29/49 (59%)
 Frame = -3

Query: 286 LVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHC 140
           ++   ++ + RG+L K+G   K WK+ + VLD+ + +L +++  +   C
Sbjct: 333 IINTSQQASKRGYLVKKGHRNK-WKRMFCVLDADEQRLSFFENEKVGSC 380


>SB_30782| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 13/49 (26%), Positives = 29/49 (59%)
 Frame = -3

Query: 286 LVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHC 140
           ++   ++ + RG+L K+G   K WK+ + VLD+ + +L +++  +   C
Sbjct: 62  IINTSQQASKRGYLVKKGHRNK-WKRMFCVLDADEQRLSFFENEKVGSC 109


>SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4700

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           WK + FVL+  ++ L Y+    D H K  + + EV  V
Sbjct: 146 WKDKLFVLNQDENSLCYFLQATDPHPKDVLKITEVNVV 183


>SB_42254| Best HMM Match : PH (HMM E-Value=5.5e-19)
          Length = 996

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
 Frame = -3

Query: 223 KGWKQRWFVL-DSIKHQLRYYDA-MEDSHCKGFIDLAEVIAV 104
           + WK+RWFVL D+I   L Y++   E +   G ID+ + + V
Sbjct: 412 RNWKRRWFVLKDNI---LTYHETDQEGAKALGTIDIRKAMRV 450


>SB_37831| Best HMM Match : MAM (HMM E-Value=0)
          Length = 563

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATP-APGPPKKCDDRSFFDL 41
           WK+  F LDS K ++  ++ +  +   G I + E+ A T+     P   K   + S   L
Sbjct: 398 WKKASFGLDSKKPKVVIFEGLRGTDYTGDIAIDEITATTKGCQLQPSGAKPSQNSSHTGL 457

Query: 40  RTSRRTYN 17
             S R  N
Sbjct: 458 EGSVRLRN 465


>SB_36954| Best HMM Match : PH (HMM E-Value=1.2e-22)
          Length = 501

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = -3

Query: 229 LLKGWKQRWFVLDSIKHQLRYYDAMEDSH-CKGFIDL 122
           L++ W++R+FVL S K +L YY + +D    K  IDL
Sbjct: 21  LMRSWQRRFFVLRSNK-KLFYYKSEKDKKPVKDPIDL 56


>SB_28135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 236

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 9/20 (45%), Positives = 17/20 (85%)
 Frame = +1

Query: 253 LVRSVLGDVRRELFIVLLRG 312
           +V +V+GD+ RE+ ++L+RG
Sbjct: 214 IVGTVMGDMEREIVLILVRG 233


>SB_891| Best HMM Match : DUF1098 (HMM E-Value=0.47)
          Length = 715

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +3

Query: 15  KLYVRRLVRKSKNDLSSHFLGGPGAGVACVTAITSAKSMNPL 140
           KL V +     + +LSS   GGPG G A       A  +NPL
Sbjct: 244 KLPVSQPTTSGQQNLSSIQEGGPGVGSASPIQEEKAPPLNPL 285


>SB_39788| Best HMM Match : Ricin_B_lectin (HMM E-Value=6.4e-14)
          Length = 784

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 70  KCDDRSFFDLRTSRRTYNFCAS 5
           KCDD SF +  + R+TY+   S
Sbjct: 505 KCDDSSFLNCHSIRKTYSHYTS 526


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,421,827
Number of Sequences: 59808
Number of extensions: 185511
Number of successful extensions: 3629
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 3586
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3627
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 678472135
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).