SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      244   2e-65
SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             240   5e-64
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              240   5e-64
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         238   2e-63
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              237   4e-63
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             176   1e-44
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   1e-21
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   1e-09
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          60   1e-09
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 55   4e-08
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               51   5e-07
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  48   3e-06
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  36   0.025
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.043
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             32   0.31 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.40 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.40 
SB_1300| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.40 
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.71 
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.93 
SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.8  
SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)                 28   3.8  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.8  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.8  
SB_21646| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.8  
SB_38695| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.6  
SB_24944| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.6  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.6  
SB_18995| Best HMM Match : rve (HMM E-Value=0.0012)                    27   6.6  
SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_28820| Best HMM Match : Sec23_BS (HMM E-Value=3.6)                  27   8.7  
SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24)                  27   8.7  
SB_486| Best HMM Match : Toxin_3 (HMM E-Value=4.5)                     27   8.7  

>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  244 bits (598), Expect = 2e-65
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  240 bits (587), Expect = 5e-64
 Identities = 109/115 (94%), Positives = 112/115 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  240 bits (587), Expect = 5e-64
 Identities = 107/115 (93%), Positives = 112/115 (97%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  238 bits (583), Expect = 2e-63
 Identities = 108/113 (95%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  237 bits (580), Expect = 4e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  176 bits (428), Expect = 1e-44
 Identities = 80/89 (89%), Positives = 84/89 (94%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTF 355
           RGILTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIMFETF 90


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score =   99 bits (238), Expect = 1e-21
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 3/110 (2%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRG 274
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VGD     R 
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDEASQLRY 66

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +L + YP+++GIV NWDDM+ +W +TF  +++ + P    VLLTE PLNP
Sbjct: 67  MLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNP 116


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +2

Query: 92   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 208
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +2

Query: 107  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 208
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130



 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 21/35 (60%), Positives = 26/35 (74%)
 Frame = +2

Query: 335  KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            K+W H F ++LRV  E+ PVLLTEAPLNPK  + R
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRER 2163


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 54.8 bits (126), Expect = 4e-08
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 3/73 (4%)
 Frame = +2

Query: 77  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYV 247
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKY 752

Query: 248 GDGHKSKRGILTL 286
           GD   +K G++ L
Sbjct: 753 GDAAVAKSGVMHL 765


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 24/60 (40%), Positives = 32/60 (53%)
 Frame = +2

Query: 221 GMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 400
           G+   D ++GD    K    T K+PI H IV +WD ME+ W    +  LR  PE+H  LL
Sbjct: 278 GVEDLDFFIGDEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 48.4 bits (110), Expect = 3e-06
 Identities = 40/130 (30%), Positives = 66/130 (50%), Gaps = 3/130 (2%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++A LV+D G+   K GFA + APR++ P+ + + + +       ++  ++GD  +  + 
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI-PNAIFKAKSE-------RRKLFIGDQIEECKD 283

Query: 275 ILTLKY--PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKALQRRR* 445
              L Y  P + G + NWD  ++IW +TF  E L  A +E  +L  E   N KAL R   
Sbjct: 284 YSALFYVLPFQKGFLVNWDVEKQIWDYTFGKEGLEDAMDE--ILFEE--YNFKALSRTTA 339

Query: 446 PQIHGSKTIQ 475
            Q+   K  Q
Sbjct: 340 AQLSAYKCHQ 349


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 35.5 bits (78), Expect = 0.025
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = +2

Query: 293 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA  N +
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTR 46


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 34.7 bits (76), Expect = 0.043
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = -1

Query: 205 MAGPSHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFV 89
           MA  + D G++ + SI+S E GLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 31.9 bits (69), Expect = 0.31
 Identities = 12/14 (85%), Positives = 14/14 (100%)
 Frame = +2

Query: 383 EHPVLLTEAPLNPK 424
           +HPVLLTEAPLNP+
Sbjct: 126 QHPVLLTEAPLNPR 139


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.40
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -2

Query: 180 GNTARGASSPAKPALHIPEPLSTT 109
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.40
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -2

Query: 180 GNTARGASSPAKPALHIPEPLSTT 109
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_1300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 31.5 bits (68), Expect = 0.40
 Identities = 15/52 (28%), Positives = 24/52 (46%)
 Frame = +3

Query: 315 LTGMTWRRFGIIPSTMSCVSPPRNTPSCLLRLPSTPRPYRGEDDPRFMVRKQ 470
           LT   +R+  + P +    +PP   P+ +      PR Y  +DDP    RK+
Sbjct: 34  LTNADFRKLLMTPRSAPSAAPPSVKPASVKETVGKPRQYNEDDDPTTARRKK 85


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 30.7 bits (66), Expect = 0.71
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +2

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP--EEHPVLLTEAPLNP 421
           L+ P +  +VT+++  E++  H F +     P    HPV++TE   NP
Sbjct: 131 LRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGGVNHPVIMTEPVCNP 178


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 0.93
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -2

Query: 180 GNTARGASSPAKPALHIPEPLSTT 109
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 652

 Score = 28.7 bits (61), Expect = 2.8
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 412 PQPQGPTEEKMTPDSWFENNSTRPAMYRRP 501
           P+P+ PTEE+  PD+  E    RP+  +RP
Sbjct: 346 PRPRLPTEER-EPDAISEEGLVRPSSVKRP 374


>SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)
          Length = 186

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = -3

Query: 272 LFCSCAHLLHKSPSVPYRPSRPDGGAFPRSRETLREEHHLLRSRPCTYRSH 120
           + CSC  + H+       PSR D   FP +       HH+L S   + R+H
Sbjct: 128 IVCSCRCVPHRVLMSMCSPSRADVDVFPITCSRRCVFHHVLMSMCSSSRAH 178


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -2

Query: 180 GNTARGASSPAKPALHIPEPLSTT 109
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -2

Query: 180 GNTARGASSPAKPALHIPEPLSTT 109
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_21646| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 178

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGLLCRRWAQEQKRYPDP--QIPHRTRN 309
           G A PSG DG  G E L         K +PDP  ++PH  RN
Sbjct: 134 GPAGPSGADGPQGPEDL---------KAHPDPLEKVPHHLRN 166


>SB_38695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 205 SGRDGRYGTEGLLCRRWAQE 264
           SG  G YG  G+ CR W QE
Sbjct: 86  SGGTGDYGIRGVHCRLWNQE 105


>SB_24944| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = -1

Query: 241 RVLLSHTDHHALMAGPSHDRGKHCARSIISCEAGLAHTGAIVYY 110
           R++ S T  H  + G  H  G H ++     EAGL     I+ +
Sbjct: 37  RLVFSATIEHEYLGGRYHSIGAHISQETSRHEAGLTQISRIIRF 80


>SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = -2

Query: 195 LPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 85
           L  IE +    A++P  P + +P+ +   +AAT +SH
Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258


>SB_18995| Best HMM Match : rve (HMM E-Value=0.0012)
          Length = 1225

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = -3

Query: 200 GAFPRSRETLREEHHLLRSRPCTYRS 123
           G +P S++T R E   + +RPCT  S
Sbjct: 832 GCYPWSKQTFRHEGPPISARPCTAMS 857


>SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 969

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 14/43 (32%), Positives = 19/43 (44%)
 Frame = -3

Query: 263 SCAHLLHKSPSVPYRPSRPDGGAFPRSRETLREEHHLLRSRPC 135
           +C    HK P   +RP    G   P+  E+L +E     S PC
Sbjct: 575 ACGEWRHKKPGYEWRPEAAWG---PKKSESLAKEPSTAPSLPC 614


>SB_28820| Best HMM Match : Sec23_BS (HMM E-Value=3.6)
          Length = 424

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +1

Query: 379 RGTPRPAY*GSPQPQGPTEEKMTPDSWFENN 471
           +GTP   Y  + Q QG    + TP S+++NN
Sbjct: 165 QGTPSSYYDNNTQEQGRLAVQGTPCSYYDNN 195


>SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24)
          Length = 766

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 205
           + +++D GS   KAGFA ++A +  + S++G   H
Sbjct: 483 SVIIIDLGSSSVKAGFAQEEA-QVFYISLIGILEH 516


>SB_486| Best HMM Match : Toxin_3 (HMM E-Value=4.5)
          Length = 334

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = -3

Query: 266 CSCAHLLHKSPSVPYRPSRPDGGAFPRSRETLREEHHLLRSRPCTYRSH 120
           CSC  +LH+       PSR + G F  +   L   H +L S   + R+H
Sbjct: 278 CSCRCVLHRGLMSMCFPSRANVGVFHIACSCLCVLHRVLMSMCSSSRAH 326


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,109,467
Number of Sequences: 59808
Number of extensions: 456508
Number of successful extensions: 1337
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1186
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1328
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1087245449
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).