SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44268| Best HMM Match : ACCA (HMM E-Value=0.58)                     49   3e-06
SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41)             32   0.33 
SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0)                   29   2.4  
SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43)                    29   3.1  
SB_9868| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_21647| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_18867| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  

>SB_44268| Best HMM Match : ACCA (HMM E-Value=0.58)
          Length = 281

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 22/57 (38%), Positives = 36/57 (63%)
 Frame = +1

Query: 259 NKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           N V  L++EIA    +  L+P Q  V+S+ A  +K+   +L+T+H+ELH  +SK G+
Sbjct: 34  NHVNNLQKEIADCNTDDELSPLQCHVLSQSAKKVKETVTRLATEHKELHGGISKIGK 90



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDI 256
           MD+C+ VE++ +K   K   +  HTD  L D+
Sbjct: 1   MDACLSVEREQEKVSKKLRGIQTHTDATLGDL 32


>SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41)
          Length = 689

 Score = 31.9 bits (69), Expect = 0.33
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 5/67 (7%)
 Frame = +1

Query: 247 ARYINKVEELRREIAQQPPNTPLTPEQAQV---VSELASTIKQNAF--QLSTDHRELHAT 411
           A Y  K+ E   + AQ P  TPL PE+  +   V  LA++I Q     Q +T   E    
Sbjct: 65  ANYAEKISEEEAKQAQSPDTTPLEPEKPHLEVSVKSLAASISQQLVGGQQATSRSETAGP 124

Query: 412 VSKSGQV 432
            S  G +
Sbjct: 125 KSGGGSL 131


>SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 313

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 15/34 (44%), Positives = 18/34 (52%)
 Frame = +3

Query: 42  FLEYTYLFKIFGKVIRSSLF*YNKASFFEKHCRD 143
           FL Y YL K F      ++   N A FFEK C+D
Sbjct: 269 FLSYEYLMKHFTPEDGRNVRVANFAGFFEKECQD 302


>SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43)
          Length = 443

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/38 (34%), Positives = 24/38 (63%)
 Frame = +1

Query: 253 YINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQ 366
           Y+N+V++ R   + +    PL+ +Q +++ ELA  IKQ
Sbjct: 241 YLNQVDKTRHRRSIRDQRKPLSLKQRRLMRELARMIKQ 278


>SB_9868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 471

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 301 PNTPLTPEQAQVVSELASTIKQNAFQLST 387
           P TP TP QA V  + A   KQ +F +++
Sbjct: 413 PQTPATPSQANVADKKAKLQKQKSFTVTS 441


>SB_21647| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 340

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = -2

Query: 306 IWWLLGYFPP-QLLYFVN--ISCNTSSVCSFKFVNFVIALSKSCSTP 175
           I +L  Y P   L+Y +N  + C+ + +  F+ + FV  L+ SC+ P
Sbjct: 237 IAYLFCYGPSCVLIYLMNFCVECSCTQIHWFRDMQFVFVLTNSCANP 283


>SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4856

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 14/55 (25%), Positives = 26/55 (47%)
 Frame = +1

Query: 262  KVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSG 426
            K+    RE+ +QP    +TP Q   +S++  T+   A Q     +++     +SG
Sbjct: 3460 KLTLAERELERQPEERAITPIQQSALSDIEETLSFLAEQSGLIEKQILEASGRSG 3514


>SB_18867| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 380

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%)
 Frame = -2

Query: 279 PQLLYFVNISCNTSSVCSFK--FVNFVI 202
           P++   +NI C TS  C F+  FVNF++
Sbjct: 341 PEVRSELNIHCETSFFCVFRIEFVNFIV 368


>SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1018

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -2

Query: 189 SCSTPIQESIVFQDSSPYSVFQKTTPYCIRTK 94
           S  T +Q S+   DS+P  V  +T P+ +R K
Sbjct: 286 SIYTGVQVSLQVDDSNPVFVKPRTVPFAVRDK 317


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,668,503
Number of Sequences: 59808
Number of extensions: 346506
Number of successful extensions: 806
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 747
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 804
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1191330434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).