SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_34789| Best HMM Match : Sushi (HMM E-Value=6.6)                     29   2.5  

>SB_34789| Best HMM Match : Sushi (HMM E-Value=6.6)
          Length = 286

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -3

Query: 649 PPIRIEV*SPS---RPSSGGTAPHPWARAPKIPATSICSIQKRAVWIVDNPIRD 497
           PPIR  V       RPS       PW++   IP TSI  +Q  A    ++PIR+
Sbjct: 2   PPIRENVLKSGTNHRPSKKPMEQPPWSQPLPIPTTSILDLQHHA-GFDNSPIRE 54


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,961,150
Number of Sequences: 59808
Number of extensions: 401737
Number of successful extensions: 709
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 669
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 709
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1681430875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).