SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)              103   1e-22
SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)               83   2e-16
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              79   3e-15
SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)              76   2e-14
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           74   7e-14
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               74   7e-14
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              72   3e-13
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  72   4e-13
SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   1e-12
SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   2e-12
SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   5e-12
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   6e-12
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     67   8e-12
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                67   8e-12
SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   3e-11
SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)               66   3e-11
SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   3e-11
SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5)                    65   3e-11
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              64   6e-11
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       64   6e-11
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          64   6e-11
SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)             64   1e-10
SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)                     64   1e-10
SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)           64   1e-10
SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)                  64   1e-10
SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 64   1e-10
SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)                  64   1e-10
SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)                     64   1e-10
SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)                64   1e-10
SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   1e-10
SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)             64   1e-10
SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)                    64   1e-10
SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)                64   1e-10
SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)        64   1e-10
SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)                    64   1e-10
SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)                        64   1e-10
SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)              63   2e-10
SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   2e-10
SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.)               62   2e-10
SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)               62   3e-10
SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   3e-10
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   4e-10
SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   5e-10
SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)                    61   5e-10
SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   5e-10
SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3)                  60   1e-09
SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9)                  60   1e-09
SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8)                 60   1e-09
SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7)                    60   1e-09
SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8)                   60   1e-09
SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3)                     60   1e-09
SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07)                 60   1e-09
SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6)            60   1e-09
SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07)        60   1e-09
SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5)             60   1e-09
SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014)          60   1e-09
SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_40003| Best HMM Match : YTV (HMM E-Value=8.9)                       60   1e-09
SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68)                60   1e-09
SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4)                    60   1e-09
SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15)             60   1e-09
SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5)                    60   1e-09
SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8)             60   1e-09
SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06)                   60   1e-09
SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46)            60   1e-09
SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08)               60   1e-09
SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10)              60   1e-09
SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14)               60   1e-09
SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014)                   60   1e-09
SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2)               60   1e-09
SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38)             60   1e-09
SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13)                60   1e-09
SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_7261| Best HMM Match : RHS (HMM E-Value=5.3)                        60   1e-09
SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_6047| Best HMM Match : CXC (HMM E-Value=7.7)                        60   1e-09
SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2)                       60   1e-09
SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031)                   60   1e-09
SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12)                     60   1e-09
SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.)                60   1e-09
SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.)                 60   1e-09
SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81)           60   1e-09
SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4)                 60   1e-09
SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4)                     60   1e-09
SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_55954| Best HMM Match : TIL (HMM E-Value=0.74)                      60   1e-09
SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77)                    60   1e-09
SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2)              60   1e-09
SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1)                      60   1e-09
SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76)                 60   1e-09
SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1)                       60   1e-09
SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7)                     60   1e-09
SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7)                60   1e-09
SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8)                60   1e-09
SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69)                    60   1e-09
SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9)             60   1e-09
SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9)             60   1e-09
SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068)                60   1e-09
SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4)             60   1e-09
SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9)                    60   1e-09
SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5)                  60   1e-09
SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2)                    60   1e-09
SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4)                    60   1e-09
SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06)                  60   1e-09
SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3)               60   1e-09
SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4)                    60   1e-09
SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44)           60   1e-09
SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_21520| Best HMM Match : Trypsin (HMM E-Value=0)                     60   1e-09
SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_20904| Best HMM Match : Filament_head (HMM E-Value=10)              60   1e-09
SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3)              60   1e-09
SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21)               60   1e-09
SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2)                  60   1e-09
SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_8817| Best HMM Match : I-set (HMM E-Value=0)                        60   1e-09
SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9)                      60   1e-09
SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3)                   60   1e-09
SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4)                 60   1e-09
SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53)                       60   1e-09
SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2)              60   1e-09
SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.)                60   1e-09
SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.)                60   1e-09
SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.)                60   1e-09
SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)                   60   2e-09
SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074)                    59   2e-09
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   2e-09
SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016)                   58   4e-09
SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0)               58   4e-09
SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17)         58   4e-09
SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2)                58   5e-09
SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   5e-09
SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   9e-09
SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   9e-09
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)           57   9e-09
SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002)                     57   9e-09
SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   9e-09
SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   9e-09
SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   9e-09
SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   9e-09
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     57   1e-08
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               57   1e-08
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)                  57   1e-08
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    57   1e-08
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)           57   1e-08
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     57   1e-08
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)             57   1e-08
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          57   1e-08
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                   57   1e-08
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        57   1e-08
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)           57   1e-08
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                   57   1e-08
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    57   1e-08
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    57   1e-08
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)                       57   1e-08
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)               57   1e-08
SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                      57   1e-08
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08

>SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)
          Length = 143

 Score =  103 bits (247), Expect = 1e-22
 Identities = 47/52 (90%), Positives = 52/52 (100%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N+IEENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS
Sbjct: 92  NYIEENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143



 Score = 75.4 bits (177), Expect = 3e-14
 Identities = 33/38 (86%), Positives = 36/38 (94%)
 Frame = -1

Query: 369 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC
Sbjct: 53  QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 90


>SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0)
          Length = 413

 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 38/42 (90%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC
Sbjct: 48  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 89



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 22/27 (81%), Positives = 27/27 (100%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGV 173
           N+IEENDEVL++GFGR+GHAVGDIPG+
Sbjct: 91  NYIEENDEVLISGFGRRGHAVGDIPGI 117


>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 38/53 (71%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = -2

Query: 542 AIGAGPLRLLRRCERGMCLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           AIGAG   +    E+G  LQGD  +G RQGFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 50  AIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102


>SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 36/49 (73%), Positives = 38/49 (77%)
 Frame = -1

Query: 561 ANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           A LL +GDRCG        RKG+VL RRLSWVTPGFSQSRRCKTTASEL
Sbjct: 2   AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 74.1 bits (174), Expect = 7e-14
 Identities = 34/52 (65%), Positives = 37/52 (71%)
 Frame = -2

Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           AIGAG   +    ERGMC +   +G    FPSHDVVKRRPVNCNTTHYRANW
Sbjct: 2   AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 74.1 bits (174), Expect = 7e-14
 Identities = 34/52 (65%), Positives = 37/52 (71%)
 Frame = -2

Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           AIGAG   +    ERGMC +   +G    FPSHDVVKRRPVNCNTTHYRANW
Sbjct: 16  AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 72.1 bits (169), Expect = 3e-13
 Identities = 30/39 (76%), Positives = 33/39 (84%)
 Frame = -2

Query: 503 ERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           ERGMC +   +G  +GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 21  ERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59



 Score = 35.1 bits (77), Expect = 0.041
 Identities = 19/35 (54%), Positives = 21/35 (60%)
 Frame = -3

Query: 553 VGKGRSVRGLFGYYAAAKGECACKAIKLGNARVFP 449
           VGKG    GLF    A +    CKAIKLGNA+ FP
Sbjct: 5   VGKGDRC-GLFAITPAGERGMCCKAIKLGNAKGFP 38


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 33/52 (63%), Positives = 36/52 (69%)
 Frame = -2

Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           AIGAG   +    ERGMC +   +     FPSHDVVKRRPVNCNTTHYRANW
Sbjct: 10  AIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61


>SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 32/45 (71%), Positives = 34/45 (75%)
 Frame = -1

Query: 549 ERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ++GDRCG        RKG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 66  QQGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110


>SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 32/44 (72%), Positives = 34/44 (77%)
 Frame = -1

Query: 546 RGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           +GDRCG        RKG+VL  RLSWVTPGFSQSRRCKTTASEL
Sbjct: 7   KGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50


>SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 30/33 (90%), Positives = 32/33 (96%)
 Frame = +3

Query: 390 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ 488
           +RP+VSRITIHW SFYNVVTGKTLALPNLIALQ
Sbjct: 33  LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQ 65


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 32/56 (57%), Positives = 35/56 (62%)
 Frame = -2

Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           CW+G        LLR+  +G C          GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 26  CWEGR-SVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 67.3 bits (157), Expect = 8e-12
 Identities = 31/51 (60%), Positives = 36/51 (70%)
 Frame = -2

Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 390
           +IGAG   +    ERGMC +   +G  +GFPSHD  KRRPVNCNTTHYRAN
Sbjct: 47  SIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 67.3 bits (157), Expect = 8e-12
 Identities = 33/52 (63%), Positives = 36/52 (69%)
 Frame = -2

Query: 542  AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
            AIGAG   +    ERGMC +   +     FPSHDVVKRRPVNCNTTHYRANW
Sbjct: 1849 AIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899


>SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = +3

Query: 396 PIVSRITIHWPSFYNVVTGKTLALPNLIALQ 488
           P +SRITIHWPSFYNVVTGKTLALPNLIALQ
Sbjct: 77  PYMSRITIHWPSFYNVVTGKTLALPNLIALQ 107


>SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 29/30 (96%), Positives = 29/30 (96%)
 Frame = +3

Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQAH 494
           SRITIHWPSFYNVVTGKTLALPNLIALQ H
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQLH 31


>SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 65.3 bits (152), Expect = 3e-11
 Identities = 29/30 (96%), Positives = 29/30 (96%)
 Frame = +3

Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQAH 494
           SRITIHWPSFYNVVTGKTLALPNLIAL AH
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALAAH 31


>SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5)
          Length = 248

 Score = 65.3 bits (152), Expect = 3e-11
 Identities = 42/93 (45%), Positives = 51/93 (54%), Gaps = 6/93 (6%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASE----L*YDSL*GELGTGPPLEKV 361
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS     L  DS    L  GP   K+
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPLRWGPHASKI 94

Query: 360 GVEAKQPNSAIRKCVR--VQLIKNGKKVTAFVP 268
             +A +    +R+ ++   QL+K     T   P
Sbjct: 95  SDKANKVLGLLRRTLKPCSQLVKERAYFTLVRP 127


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 32/56 (57%), Positives = 35/56 (62%)
 Frame = -2

Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           CW+G        LLR+  +G C          GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 597 CWEGR-SVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 648


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 32/56 (57%), Positives = 35/56 (62%)
 Frame = -2

Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           CW+G        LLR+  +G C          GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 40  CWEGR-SVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 32/56 (57%), Positives = 35/56 (62%)
 Frame = -2

Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387
           CW+G        LLR+  +G C          GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 40  CWEGR-SVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91


>SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 64.1 bits (149), Expect = 8e-11
 Identities = 32/46 (69%), Positives = 33/46 (71%)
 Frame = -1

Query: 552 LERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           L  G    ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 4   LWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49


>SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)
          Length = 269

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 232 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269


>SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 937

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528  ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
            ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 900  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937


>SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)
          Length = 424

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 387 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424


>SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)
          Length = 273

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 236 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273


>SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)
          Length = 340

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 303 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340


>SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 406

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 369 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406


>SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)
          Length = 98

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 61  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98


>SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 372

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 25/26 (96%), Positives = 25/26 (96%)
 Frame = -2

Query: 464 RQGFPSHDVVKRRPVNCNTTHYRANW 387
           R GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 55  RSGFPSHDVVKRRPVNCNTTHYRANW 80


>SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 43  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80


>SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)
          Length = 316

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 279 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316


>SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)
          Length = 300

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 263 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300


>SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)
          Length = 289

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 252 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289


>SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)
          Length = 314

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 277 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314


>SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 498

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 461 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498


>SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)
          Length = 455

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 130 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167


>SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)
          Length = 333

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 296 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333


>SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 146 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183


>SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 6   ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43


>SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 242

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 205 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242


>SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)
          Length = 634

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 597 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634


>SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2021

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 233 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270


>SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 511 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548


>SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 94  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131


>SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 439

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 402 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439


>SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 6   ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43


>SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)
          Length = 232

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASEL
Sbjct: 195 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232


>SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ 488
           SRITIHWPSFYNVVTGKTLALPNLIALQ
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQ 29


>SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 31/43 (72%), Positives = 32/43 (74%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL*YDSL 400
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASE   D L
Sbjct: 20  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 28/36 (77%), Positives = 30/36 (83%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEA 529
           LAVVLQRRDWENPGVTQLNRLA+  PF S   +EEA
Sbjct: 85  LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 120


>SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ 488
           SRITIHWPSFYNVVTGKTLALPNLIALQ
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQ 29


>SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)
          Length = 98

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ 488
           SRITIHWPSFYNVVTGKTLALPNLIALQ
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQ 29


>SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 33/47 (70%), Positives = 34/47 (72%)
 Frame = -1

Query: 561 ANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           A LLE G    ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 17  AQLLE-GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62


>SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 3/52 (5%)
 Frame = -1

Query: 567 AGANLLER---GDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           AG N+L     G    ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 46  AGKNMLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97


>SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 925

 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 29/37 (78%), Positives = 30/37 (81%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASE 418
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTASE
Sbjct: 542 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578


>SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 30/50 (60%), Positives = 33/50 (66%)
 Frame = -1

Query: 564 GANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           G   + +GDRCG        RKG+  A RLS  TPGFSQSRRCKTTASEL
Sbjct: 30  GCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Frame = -2

Query: 458 GFPSHDVVKRRPVNCNTTHYRANW 387
           GFPSHDVVKRRPVNCNTTHYRANW
Sbjct: 1   GFPSHDVVKRRPVNCNTTHYRANW 24


>SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 61.3 bits (142), Expect = 5e-10
 Identities = 32/51 (62%), Positives = 33/51 (64%)
 Frame = -1

Query: 573 FQAGANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           F   A  L  G    ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 12  FAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62


>SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)
          Length = 142

 Score = 61.3 bits (142), Expect = 5e-10
 Identities = 30/41 (73%), Positives = 31/41 (75%)
 Frame = +3

Query: 372 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQAH 494
           GGA  PIRPIVSRITIHWP+FYN  TGKTLA   L  L AH
Sbjct: 36  GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAH 74


>SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 61.3 bits (142), Expect = 5e-10
 Identities = 32/51 (62%), Positives = 33/51 (64%)
 Frame = -1

Query: 573 FQAGANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           F   A  L  G    ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 12  FAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62


>SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 31/46 (67%), Positives = 32/46 (69%)
 Frame = -1

Query: 552 LERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415
           L  G    ASS +  L KG   ARRLSWVTP FSQSRRCKTTASEL
Sbjct: 4   LWEGRSVRASSLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49


>SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3)
          Length = 666

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 33/50 (66%), Positives = 34/50 (68%)
 Frame = -1

Query: 570 QAGANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           QA  N  E G    ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 405 QALRNCWE-GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453


>SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3213

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 488 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523


>SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9)
          Length = 123

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8)
          Length = 212

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 158 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193


>SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 328

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 235 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270


>SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 379 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414


>SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7)
          Length = 141

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 69

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8)
          Length = 533

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 81  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116


>SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3)
          Length = 185

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07)
          Length = 1127

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 662 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697


>SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 473

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6)
          Length = 388

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07)
          Length = 305

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5)
          Length = 154

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 115

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014)
          Length = 735

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 571 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606


>SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40003| Best HMM Match : YTV (HMM E-Value=8.9)
          Length = 128

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68)
          Length = 794

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 104

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 45  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80


>SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1081

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 801 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836


>SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4)
          Length = 240

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15)
          Length = 631

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 462 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497


>SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5)
          Length = 297

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8)
          Length = 143

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 81  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116


>SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06)
          Length = 214

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 534

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 383 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418


>SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46)
          Length = 1232

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528  ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
            ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 1117 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152


>SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08)
          Length = 412

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 308 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343


>SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1758

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 122 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157


>SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 32  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67


>SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 6   ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41


>SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10)
          Length = 466

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14)
          Length = 322

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014)
          Length = 230

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 48  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83


>SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2)
          Length = 218

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38)
          Length = 742

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 498 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533


>SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13)
          Length = 184

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 106 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141


>SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 66  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101


>SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 68  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103


>SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_7261| Best HMM Match : RHS (HMM E-Value=5.3)
          Length = 137

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_6047| Best HMM Match : CXC (HMM E-Value=7.7)
          Length = 90

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 374

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 69

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2)
          Length = 542

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 167 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202


>SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031)
          Length = 546

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12)
          Length = 338

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81)
          Length = 427

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4)
          Length = 200

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 27  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62


>SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4)
          Length = 220

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_55954| Best HMM Match : TIL (HMM E-Value=0.74)
          Length = 172

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77)
          Length = 316

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 69

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2)
          Length = 253

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 204 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239


>SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 196

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 140 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175


>SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1)
          Length = 195

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76)
          Length = 250

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1)
          Length = 283

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 111 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146


>SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 109

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 849

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 67  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102


>SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7)
          Length = 144

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 224

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 85

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7)
          Length = 128

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 60

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 6   ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41


>SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8)
          Length = 271

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69)
          Length = 199

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 60

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 6   ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41


>SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9)
          Length = 152

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9)
          Length = 206

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068)
          Length = 229

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


>SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 13  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48


>SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4)
          Length = 164

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/36 (77%), Positives = 29/36 (80%)
 Frame = -1

Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421
           ASS +  L KG   ARRLSWVTPGFSQSRRCKTTAS
Sbjct: 35  ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,608,950
Number of Sequences: 59808
Number of extensions: 446227
Number of successful extensions: 4592
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 3882
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4551
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1361520496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).