SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14)             114   6e-26
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   2e-10
SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   2e-09
SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   2e-07
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   2e-07
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              52   3e-07
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   5e-07
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   6e-07
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       51   6e-07
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          51   6e-07
SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   8e-07
SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)              51   8e-07
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               50   1e-06
SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)                    50   2e-06
SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)               50   2e-06
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  49   3e-06
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           49   3e-06
SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   6e-06
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                47   1e-05
SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   4e-05
SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   7e-05
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     44   7e-05
SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5)                   44   9e-05
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)                   42   4e-04
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   4e-04
SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   7e-04
SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   7e-04
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   7e-04
SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)             40   0.002
SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)                     40   0.002
SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)           40   0.002
SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)                  40   0.002
SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 40   0.002
SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)                  40   0.002
SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)                     40   0.002
SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)                40   0.002
SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)             40   0.002
SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)                    40   0.002
SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)                40   0.002
SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)        40   0.002
SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)                    40   0.002
SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)                        40   0.002
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     39   0.003
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               39   0.003
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)                  39   0.003
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    39   0.003
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)           39   0.003
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     39   0.003
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)             39   0.003
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          39   0.003
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                   39   0.003
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        39   0.003
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)           39   0.003
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                   39   0.003
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    39   0.003
SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    39   0.003
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    39   0.003
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)                       39   0.003
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)               39   0.003
SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                      39   0.003
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)                39   0.003
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)                      39   0.003
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)               39   0.003
SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)                39   0.003
SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)                    39   0.003
SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)                    39   0.003
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46412| Best HMM Match : HEAT (HMM E-Value=8)                        39   0.003
SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)                     39   0.003
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)                    39   0.003
SB_46308| Best HMM Match : IMS (HMM E-Value=0)                         39   0.003
SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)               39   0.003
SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)                 39   0.003
SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074)                    39   0.003
SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)                      39   0.003
SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)                 39   0.003
SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003)               39   0.003
SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)                    39   0.003
SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)        39   0.003
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)                   39   0.003
SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)                    39   0.003
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)                39   0.003
SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)                 39   0.003
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)                39   0.003
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)                 39   0.003
SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)               39   0.003
SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2)             39   0.003
SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)               39   0.003
SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)             39   0.003
SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78)              39   0.003
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)             39   0.003
SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34793| Best HMM Match : TIL (HMM E-Value=4.5)                       39   0.003
SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3)             39   0.003
SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                         39   0.003
SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15)                 39   0.003
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                 39   0.003
SB_32525| Best HMM Match : DED (HMM E-Value=0.81)                      39   0.003
SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)              39   0.003
SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6)                    39   0.003
SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31658| Best HMM Match : Arm (HMM E-Value=0.91)                      39   0.003
SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)              39   0.003
SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076)                    39   0.003
SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)                     39   0.003
SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4)              39   0.003
SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021)                   39   0.003
SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05)                     39   0.003
SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038)                     39   0.003
SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003

>SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14)
          Length = 441

 Score =  114 bits (274), Expect = 6e-26
 Identities = 50/73 (68%), Positives = 60/73 (82%)
 Frame = +2

Query: 236 VTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           V G  P S+D+KI NFSITF+G ELL D  LELN GR+YGL+GLNGCGKS++L A+ +RE
Sbjct: 46  VLGSHPMSKDVKIDNFSITFHGVELLTDAKLELNTGRKYGLIGLNGCGKSTMLTAIGKRE 105

Query: 416 VPIPEHIDIFHLT 454
           +PIPEH DIFHLT
Sbjct: 106 IPIPEHFDIFHLT 118


>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%)
 Frame = -3

Query: 586 RGNVLQGN*-VGERQGFPSHNVCKTTAVNCNTTHYRANW 473
           +G+VLQG+  +G+RQGFPSH+V K   VNCNTTHYRANW
Sbjct: 64  KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102


>SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 28/36 (77%), Positives = 30/36 (83%)
 Frame = +2

Query: 476 IRPIVSRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583
           +RP+VSRITIH   F NVVTGKTLA PNLIALQ IP
Sbjct: 33  LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68


>SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 683

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 28/65 (43%), Positives = 42/65 (64%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S+DI+I NF + +    LL+   L +  GRRYGLVG NG GK++LL  L +RE+ +  +I
Sbjct: 204 SQDIRIENFDLAYGNRSLLKGANLAIAFGRRYGLVGRNGIGKTTLLRTLSKRELFVASNI 263

Query: 437 DIFHL 451
            I ++
Sbjct: 264 SILYV 268


>SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/32 (81%), Positives = 26/32 (81%)
 Frame = +2

Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586
           SRITIH   F NVVTGKTLA PNLIALQ IPP
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQHIPP 33


>SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 27/34 (79%)
 Frame = +2

Query: 482 PIVSRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583
           P +SRITIH   F NVVTGKTLA PNLIALQ IP
Sbjct: 77  PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 22/39 (56%), Positives = 27/39 (69%)
 Frame = -3

Query: 550 RQGFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           R GFPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 55  RSGFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 93


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 22/38 (57%), Positives = 26/38 (68%)
 Frame = -3

Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANW 473
           RG   +   +G  +GFPSH+V K   VNCNTTHYRANW
Sbjct: 22  RGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = -3

Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVNVFRNRNLTAS 404
           GFPSH+V K   VNCNTTHYRANW     ++ +E V+    RN  +S
Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVDPPGCRNSISS 671



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQR 525
           KG C AR+LSWG P     +R
Sbjct: 614 KGGCAARRLSWGFPSHDVVKR 634


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 24/46 (52%), Positives = 29/46 (63%)
 Frame = -3

Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVNVFRNRNLTA 407
           GFPSH+V K   VNCNTTHYRANW     ++ +E V+    RN  A
Sbjct: 57  GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVDPPGCRNSIA 102



 Score = 31.1 bits (67), Expect = 0.70
 Identities = 12/16 (75%), Positives = 13/16 (81%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGF 540
           KG C AR+LSW TPGF
Sbjct: 43  KGGCAARRLSWVTPGF 58


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = -3

Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           GFPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 1   GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 37


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = -3

Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           GFPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 68  GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 104



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQR 525
           KG C AR+LSWG P     +R
Sbjct: 57  KGGCAARRLSWGFPSHDVVKR 77


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = -3

Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           GFPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 68  GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 104



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQR 525
           KG C AR+LSWG P     +R
Sbjct: 57  KGGCAARRLSWGFPSHDVVKR 77


>SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 25/31 (80%), Positives = 25/31 (80%)
 Frame = +2

Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583
           SRITIH   F NVVTGKTLA PNLIALQ IP
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32


>SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)
          Length = 98

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 25/31 (80%), Positives = 25/31 (80%)
 Frame = +2

Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583
           SRITIH   F NVVTGKTLA PNLIALQ IP
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = -3

Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           RG   +   +G    FPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 30  RGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 80


>SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)
          Length = 142

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 28/45 (62%), Positives = 29/45 (64%)
 Frame = +2

Query: 452 TRGGARYPIRPIVSRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586
           T GGA  PIRPIVSRITIH   F N  TGKTLA+  L  L   PP
Sbjct: 34  TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPP 76


>SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 25/32 (78%), Positives = 25/32 (78%)
 Frame = +2

Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586
           SRITIH   F NVVTGKTLA PNLIALQ  PP
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQLHPP 33


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = -3

Query: 541 FPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           FPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 39  FPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 74



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 16/25 (64%), Positives = 18/25 (72%)
 Frame = -1

Query: 582 GMSCKAIKLGNARVFPVTTFVKRRP 508
           GM CK+IKL +A VFP    VKRRP
Sbjct: 25  GMCCKSIKLAHASVFPSHDVVKRRP 49


>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = -3

Query: 541 FPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           FPSH+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 37  FPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 72


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 21/38 (55%), Positives = 24/38 (63%)
 Frame = -3

Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANW 473
           RG   +   +G    FPSH+V K   VNCNTTHYRANW
Sbjct: 16  RGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53


>SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 24/32 (75%), Positives = 24/32 (75%)
 Frame = +2

Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586
           SRITIH   F NVVTGKTLA PNLIAL   PP
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALAAHPP 33


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = -3

Query: 541  FPSHNVCKTTAVNCNTTHYRANW 473
            FPSH+V K   VNCNTTHYRANW
Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/25 (64%), Positives = 16/25 (64%)
 Frame = -1

Query: 582  GMSCKAIKLGNARVFPVTTFVKRRP 508
            GM CKAIKL    VFP    VKRRP
Sbjct: 1864 GMCCKAIKLVTP-VFPSHDVVKRRP 1887


>SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/25 (84%), Positives = 22/25 (88%)
 Frame = +2

Query: 509 GRRFTNVVTGKTLAFPNLIALQDIP 583
           GRRFT +VTGKTLA PNLIALQ IP
Sbjct: 56  GRRFTTLVTGKTLALPNLIALQHIP 80


>SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 19/24 (79%), Positives = 19/24 (79%)
 Frame = +1

Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588
           FYKR DWENPGV QLN LA H PF
Sbjct: 32  FYKRRDWENPGVNQLNRLAAHPPF 55


>SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 22/31 (70%), Positives = 23/31 (74%)
 Frame = +2

Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583
           SRITIH   F NVVTGKTLA PNL  L+ IP
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLFDLRHIP 32


>SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 472

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 2/62 (3%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           P   ++K  N S+ +Y  G ++L +  +++  G R G+ G  G GKSSL+AAL R  +P 
Sbjct: 227 PAHGNVKFENVSLRYYEGGPQVLHNLNIDIKGGERVGVAGRTGAGKSSLVAALFR--MPD 284

Query: 425 PE 430
           PE
Sbjct: 285 PE 286


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 20/37 (54%), Positives = 24/37 (64%)
 Frame = -3

Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRAN 476
           RG   +   +G  +GFPSH+  K   VNCNTTHYRAN
Sbjct: 61  RGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97


>SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5)
          Length = 107

 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = -1

Query: 582 GMSCKAIKLGNARVFPVTTF 523
           GM CKAIKLGNARVFPVTTF
Sbjct: 38  GMCCKAIKLGNARVFPVTTF 57


>SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)
          Length = 257

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = -3

Query: 532 HNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           H+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 2   HDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 34


>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = -3

Query: 532 HNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           H+V K   VNCNTTHYRANW     ++ +E V+
Sbjct: 2   HDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 34


>SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 109

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/26 (76%), Positives = 20/26 (76%)
 Frame = +2

Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583
           H   F NVVTGKTLA PNLIALQ IP
Sbjct: 62  HWPSFYNVVTGKTLALPNLIALQHIP 87


>SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/26 (76%), Positives = 20/26 (76%)
 Frame = +2

Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583
           H   F NVVTGKTLA PNLIALQ IP
Sbjct: 5   HWPSFYNVVTGKTLALPNLIALQHIP 30


>SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 104

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/26 (76%), Positives = 20/26 (76%)
 Frame = +2

Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583
           H   F NVVTGKTLA PNLIALQ IP
Sbjct: 57  HWPSFYNVVTGKTLALPNLIALQHIP 82


>SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1250

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
 Frame = +2

Query: 266  IKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
            + + N S+ +Y    E+L+D    +N   R G+ G  G GKSSL++AL R  +P PE
Sbjct: 1010 VDLVNVSLAYYPGAPEVLKDVTFSINPAERVGIAGRTGAGKSSLVSALFR--MPDPE 1064


>SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 19/24 (79%), Positives = 19/24 (79%)
 Frame = -1

Query: 579 MSCKAIKLGNARVFPVTTFVKRRP 508
           M CKAIKLGNARVFP    VKRRP
Sbjct: 1   MCCKAIKLGNARVFPSHDVVKRRP 24


>SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 17/24 (70%), Positives = 18/24 (75%)
 Frame = +1

Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588
           F +R DWENPGV QLN LA H PF
Sbjct: 68  FLQRRDWENPGVTQLNRLAAHPPF 91


>SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 17/24 (70%), Positives = 18/24 (75%)
 Frame = +1

Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588
           F +R DWENPGV QLN LA H PF
Sbjct: 11  FLQRRDWENPGVTQLNRLAAHPPF 34


>SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = -3

Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434
           RG   +   +G    F SH+V K   VNCNTTHYRAN      ++ +E V+
Sbjct: 4   RGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRANRSSTAVAAALELVD 54


>SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = +1

Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588
           F +R DWENPGV QLN L  H PF
Sbjct: 19  FLQRRDWENPGVTQLNLLGAHPPF 42


>SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 70  QRLDWENPGVTQLNRLAAHPPF 91


>SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN L GH PF
Sbjct: 13  QRRDWENPGVTQLNRLGGHPPF 34


>SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 70  QRLDWENPGVTQLNRLAAHPPF 91


>SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 29  KGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/23 (69%), Positives = 17/23 (73%)
 Frame = +1

Query: 520 YKRCDWENPGVPQLNCLAGHSPF 588
           + R DWENPGV QLN LA H PF
Sbjct: 44  FTRRDWENPGVTQLNRLAAHPPF 66


>SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)
          Length = 269

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 241 KGGCAARRLSWVTPGFSQSRRCKTTASEL 269


>SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 937

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937


>SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 22  KGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 21  KGGCAARRLSWVTPGFSQSRRCKTTASEL 49


>SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)
          Length = 424

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 396 KGGCAARRLSWVTPGFSQSRRCKTTASEL 424


>SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)
          Length = 273

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273


>SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)
          Length = 340

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 312 KGGCAARRLSWVTPGFSQSRRCKTTASEL 340


>SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 406

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406


>SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)
          Length = 98

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 70  KGGCAARRLSWVTPGFSQSRRCKTTASEL 98


>SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 372

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 29  KGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 22  KGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 22  KGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 29  KGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 29  KGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 52  KGGCAARRLSWVTPGFSQSRRCKTTASEL 80


>SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)
          Length = 316

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316


>SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)
          Length = 300

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300


>SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 22  KGGCAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/50 (42%), Positives = 24/50 (48%)
 Frame = +1

Query: 439 HIPSDSRGGPVXXXXXXXXXXXXXXXFYKRCDWENPGVPQLNCLAGHSPF 588
           H+ S  RG P+                 +R DWENPGV QLN LA H PF
Sbjct: 16  HLKSSLRGDPLESTCRHASLALAVVL--QRRDWENPGVTQLNRLAAHPPF 63


>SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)
          Length = 289

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289


>SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)
          Length = 314

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 286 KGGCAARRLSWVTPGFSQSRRCKTTASEL 314


>SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 102

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 16  RRRDWENPGVTQLNRLAAHPPF 37


>SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 498

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 470 KGGCAARRLSWVTPGFSQSRRCKTTASEL 498


>SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)
          Length = 455

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167


>SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)
          Length = 333

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 305 KGGCAARRLSWVTPGFSQSRRCKTTASEL 333


>SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 155 KGGCAARRLSWVTPGFSQSRRCKTTASEL 183


>SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 29  KGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376


>SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 29  KGGCAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 15  KGGCAARRLSWVTPGFSQSRRCKTTASEL 43


>SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 242

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242


>SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)
          Length = 634

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 606 KGGCAARRLSWVTPGFSQSRRCKTTASEL 634


>SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2021

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270


>SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 82  KGGCAARRLSWVTPGFSQSRRCKTTASEL 110


>SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 520 KGGCAARRLSWVTPGFSQSRRCKTTASEL 548


>SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131


>SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 439

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439


>SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 15  KGGCAARRLSWVTPGFSQSRRCKTTASEL 43


>SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)
          Length = 232

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -2

Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501
           KG C AR+LSW TPGFSQS+R      EL
Sbjct: 204 KGGCAARRLSWVTPGFSQSRRCKTTASEL 232


>SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 40  QRRDWENPGVTQLNRLAAHPPF 61


>SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 20  QRRDWENPGVTQLNRLAAHPPF 41


>SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 67  QRRDWENPGVTQLNRLAAHPPF 88


>SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 49  QRRDWENPGVTQLNRLAAHPPF 70


>SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 41  QRRDWENPGVTQLNRLAAHPPF 62


>SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 67  QRRDWENPGVTQLNRLAAHPPF 88


>SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 72  QRRDWENPGVTQLNRLAAHPPF 93


>SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 43  QRRDWENPGVTQLNRLAAHPPF 64


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 63  QRRDWENPGVTQLNRLAAHPPF 84


>SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 75  QRRDWENPGVTQLNRLAAHPPF 96


>SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 51  QRRDWENPGVTQLNRLAAHPPF 72


>SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 40  QRRDWENPGVTQLNRLAAHPPF 61


>SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 30  QRRDWENPGVTQLNRLAAHPPF 51


>SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 55  QRRDWENPGVTQLNRLAAHPPF 76


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 64  QRRDWENPGVTQLNRLAAHPPF 85


>SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 58  QRRDWENPGVTQLNRLAAHPPF 79


>SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 74  QRRDWENPGVTQLNRLAAHPPF 95


>SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 62  QRRDWENPGVTQLNRLAAHPPF 83


>SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 45  QRRDWENPGVTQLNRLAAHPPF 66


>SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)
          Length = 297

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 221 QRRDWENPGVTQLNRLAAHPPF 242


>SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 116 QRRDWENPGVTQLNRLAAHPPF 137


>SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 54  QRRDWENPGVTQLNRLAAHPPF 75


>SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 33  QRRDWENPGVTQLNRLAAHPPF 54


>SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 21  QRRDWENPGVTQLNRLAAHPPF 42


>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 52  QRRDWENPGVTQLNRLAAHPPF 73


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 386 QRRDWENPGVTQLNRLAAHPPF 407


>SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)
          Length = 198

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 112 QRRDWENPGVTQLNRLAAHPPF 133


>SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 88  QRRDWENPGVTQLNRLAAHPPF 109


>SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 44  QRRDWENPGVTQLNRLAAHPPF 65


>SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 13  QRRDWENPGVTQLNRLAAHPPF 34


>SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 23  QRRDWENPGVTQLNRLAAHPPF 44


>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
          Length = 129

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 43  QRRDWENPGVTQLNRLAAHPPF 64


>SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 108 QRRDWENPGVTQLNRLAAHPPF 129


>SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 50  QRRDWENPGVTQLNRLAAHPPF 71


>SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 345 QRRDWENPGVTQLNRLAAHPPF 366


>SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 85  QRRDWENPGVTQLNRLAAHPPF 106


>SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 55  QRRDWENPGVTQLNRLAAHPPF 76


>SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 21  QRRDWENPGVTQLNRLAAHPPF 42


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 64  QRRDWENPGVTQLNRLAAHPPF 85


>SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 48  QRRDWENPGVTQLNRLAAHPPF 69


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 139 QRRDWENPGVTQLNRLAAHPPF 160


>SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 68  QRRDWENPGVTQLNRLAAHPPF 89


>SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 44  QRRDWENPGVTQLNRLAAHPPF 65


>SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)
          Length = 295

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 148 QRRDWENPGVTQLNRLAAHPPF 169


>SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 917

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 838 QRRDWENPGVTQLNRLAAHPPF 859


>SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 21  QRRDWENPGVTQLNRLAAHPPF 42


>SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 65  QRRDWENPGVTQLNRLAAHPPF 86


>SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 39  QRRDWENPGVTQLNRLAAHPPF 60


>SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 78  QRRDWENPGVTQLNRLAAHPPF 99


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 72  QRRDWENPGVTQLNRLAAHPPF 93


>SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 61  QRRDWENPGVTQLNRLAAHPPF 82


>SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 74  QRRDWENPGVTQLNRLAAHPPF 95


>SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 261 QRRDWENPGVTQLNRLAAHPPF 282


>SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)
          Length = 195

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 119 QRRDWENPGVTQLNRLAAHPPF 140


>SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 55  QRRDWENPGVTQLNRLAAHPPF 76


>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 41  QRRDWENPGVTQLNRLAAHPPF 62


>SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 42  QRRDWENPGVTQLNRLAAHPPF 63


>SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)
          Length = 192

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 106 QRRDWENPGVTQLNRLAAHPPF 127


>SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 119 QRRDWENPGVTQLNRLAAHPPF 140


>SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 44  QRRDWENPGVTQLNRLAAHPPF 65


>SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 25  QRRDWENPGVTQLNRLAAHPPF 46


>SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 63  QRRDWENPGVTQLNRLAAHPPF 84


>SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 42  QRRDWENPGVTQLNRLAAHPPF 63


>SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 39  QRRDWENPGVTQLNRLAAHPPF 60


>SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)
          Length = 349

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 16  QRRDWENPGVTQLNRLAAHPPF 37


>SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 24  QRRDWENPGVTQLNRLAAHPPF 45


>SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 487

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 401 QRRDWENPGVTQLNRLAAHPPF 422


>SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 50  QRRDWENPGVTQLNRLAAHPPF 71


>SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 59  QRRDWENPGVTQLNRLAAHPPF 80


>SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 41  QRRDWENPGVTQLNRLAAHPPF 62


>SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 124 QRRDWENPGVTQLNRLAAHPPF 145


>SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 60  QRRDWENPGVTQLNRLAAHPPF 81


>SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 70  QRRDWENPGVTQLNRLAAHPPF 91


>SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 73  QRRDWENPGVTQLNRLAAHPPF 94


>SB_54473| Best HMM Match : DLIC (HMM E-Value=0)
          Length = 1401

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 419 QRRDWENPGVTQLNRLAAHPPF 440


>SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)
          Length = 174

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 116 QRRDWENPGVTQLNRLAAHPPF 137


>SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)
          Length = 157

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 72  QRRDWENPGVTQLNRLAAHPPF 93


>SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 61  QRRDWENPGVTQLNRLAAHPPF 82


>SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)
          Length = 137

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 51  QRRDWENPGVTQLNRLAAHPPF 72


>SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)
          Length = 140

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 54  QRRDWENPGVTQLNRLAAHPPF 75


>SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 166 QRRDWENPGVTQLNRLAAHPPF 187


>SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 70  QRRDWENPGVTQLNRLAAHPPF 91


>SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 57  QRRDWENPGVTQLNRLAAHPPF 78


>SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 93  QRRDWENPGVTQLNRLAAHPPF 114


>SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 42  QRRDWENPGVTQLNRLAAHPPF 63


>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 68  QRRDWENPGVTQLNRLAAHPPF 89


>SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 47  QRRDWENPGVTQLNRLAAHPPF 68


>SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 300

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 190 QRRDWENPGVTQLNRLAAHPPF 211


>SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 39  QRRDWENPGVTQLNRLAAHPPF 60


>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 45  QRRDWENPGVTQLNRLAAHPPF 66


>SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 59  QRRDWENPGVTQLNRLAAHPPF 80


>SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)
          Length = 142

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 56  QRRDWENPGVTQLNRLAAHPPF 77


>SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 39  QRRDWENPGVTQLNRLAAHPPF 60


>SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 40  QRRDWENPGVTQLNRLAAHPPF 61


>SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 54  QRRDWENPGVTQLNRLAAHPPF 75


>SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 44  QRRDWENPGVTQLNRLAAHPPF 65


>SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 137 QRRDWENPGVTQLNRLAAHPPF 158


>SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 46  QRRDWENPGVTQLNRLAAHPPF 67


>SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 89  QRRDWENPGVTQLNRLAAHPPF 110


>SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 27  QRRDWENPGVTQLNRLAAHPPF 48


>SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)
          Length = 234

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 158 QRRDWENPGVTQLNRLAAHPPF 179


>SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
          Length = 473

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 345 QRRDWENPGVTQLNRLAAHPPF 366


>SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 62  QRRDWENPGVTQLNRLAAHPPF 83


>SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 26  QRRDWENPGVTQLNRLAAHPPF 47


>SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 52  QRRDWENPGVTQLNRLAAHPPF 73


>SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)
          Length = 301

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 114 QRRDWENPGVTQLNRLAAHPPF 135


>SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 91  QRRDWENPGVTQLNRLAAHPPF 112


>SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 41  QRRDWENPGVTQLNRLAAHPPF 62


>SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 65  QRRDWENPGVTQLNRLAAHPPF 86


>SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)
          Length = 385

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 299 QRRDWENPGVTQLNRLAAHPPF 320


>SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 62  QRRDWENPGVTQLNRLAAHPPF 83


>SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 63  QRRDWENPGVTQLNRLAAHPPF 84


>SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 21  QRRDWENPGVTQLNRLAAHPPF 42


>SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 41  QRRDWENPGVTQLNRLAAHPPF 62


>SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 857

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 416 QRRDWENPGVTQLNRLAAHPPF 437


>SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 100 QRRDWENPGVTQLNRLAAHPPF 121


>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 56  QRRDWENPGVTQLNRLAAHPPF 77


>SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 48  QRRDWENPGVTQLNRLAAHPPF 69


>SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 98  QRRDWENPGVTQLNRLAAHPPF 119


>SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 48  QRRDWENPGVTQLNRLAAHPPF 69


>SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 216 QRRDWENPGVTQLNRLAAHPPF 237


>SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 48  QRRDWENPGVTQLNRLAAHPPF 69


>SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1615

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 218 QRRDWENPGVTQLNRLAAHPPF 239


>SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 38  QRRDWENPGVTQLNRLAAHPPF 59


>SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 53  QRRDWENPGVTQLNRLAAHPPF 74


>SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 43  QRRDWENPGVTQLNRLAAHPPF 64


>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 48  QRRDWENPGVTQLNRLAAHPPF 69


>SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 238

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 152 QRRDWENPGVTQLNRLAAHPPF 173


>SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 50  QRRDWENPGVTQLNRLAAHPPF 71


>SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 40  QRRDWENPGVTQLNRLAAHPPF 61


>SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 60  QRRDWENPGVTQLNRLAAHPPF 81


>SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 45  QRRDWENPGVTQLNRLAAHPPF 66


>SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 80  QRRDWENPGVTQLNRLAAHPPF 101


>SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)
          Length = 286

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 200 QRRDWENPGVTQLNRLAAHPPF 221


>SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 58  QRRDWENPGVTQLNRLAAHPPF 79


>SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 37  QRRDWENPGVTQLNRLAAHPPF 58


>SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 237

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 91  QRRDWENPGVTQLNRLAAHPPF 112


>SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 27  QRRDWENPGVTQLNRLAAHPPF 48


>SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 54  QRRDWENPGVTQLNRLAAHPPF 75


>SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


>SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)
          Length = 325

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 192 QRRDWENPGVTQLNRLAAHPPF 213


>SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 34  QRRDWENPGVTQLNRLAAHPPF 55


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,843,270
Number of Sequences: 59808
Number of extensions: 355401
Number of successful extensions: 3871
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 3638
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3862
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1422302661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).