SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_35001| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.41 
SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_51129| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_46218| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  
SB_26621| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  
SB_23937| Best HMM Match : PAN (HMM E-Value=0.12)                      28   6.7  

>SB_35001| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 31.9 bits (69), Expect = 0.41
 Identities = 15/47 (31%), Positives = 20/47 (42%)
 Frame = -1

Query: 543 YTLSGPGCVENAFLFFVQFHLFENHKTHTRFYIFKFDSFNDSSPRHG 403
           + L GP C    F FF  F  + N   +   Y F   +F   S R+G
Sbjct: 194 FVLDGPNCSLRVFFFFAMFLAYMNSAVNPGIYHFFSRNFRKVSKRNG 240


>SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 796

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = -1

Query: 519 VENAFLFFVQFHLFENHKTHTRFYI 445
           VE  FL+ +  ++FE+HK H + Y+
Sbjct: 377 VEGVFLYIMVVNVFESHKDHMKVYL 401


>SB_51129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = +1

Query: 508 GIFNATRATQGIFWLWLYRKTWTGLLLKLPW 600
           G     RA +  FW+W     +TG+  K PW
Sbjct: 38  GYAGYVRARKNCFWIWPNVLVFTGIKTKAPW 68


>SB_46218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 644

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -1

Query: 129 PFINLSPPYPTRWGRHSEFFYSILFYRPS 43
           PFI  SP +  RWG  SE F S++   P+
Sbjct: 90  PFIVSSPYHTKRWGEVSEAFVSLVDIVPT 118


>SB_26621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 359

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = -1

Query: 537 LSGPGCVE-NAFLFFVQFHLFENHKTHTRFYIFKFDSFNDSSPR 409
           +S   C+  NA LF + F  + N       Y+F  + FN S+ +
Sbjct: 278 ISAAFCINWNALLFAIYFLFYVNFTASPFIYVFFLEDFNSSAKK 321


>SB_23937| Best HMM Match : PAN (HMM E-Value=0.12)
          Length = 270

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = -2

Query: 305 SSSANVYTRTLELISQGSGGFTL*MSMGSSN 213
           S + +VY +  +L++ G GG+TL M +  SN
Sbjct: 235 SKTIDVYCQMTDLLNCGGGGWTLVMKIDGSN 265


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,231,840
Number of Sequences: 59808
Number of extensions: 390514
Number of successful extensions: 730
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 684
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 730
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1475788250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).