SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_28264| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.0  
SB_31840| Best HMM Match : RuvA_N (HMM E-Value=5.6)                    28   4.6  
SB_24073| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  
SB_24193| Best HMM Match : Acetyltransf_1 (HMM E-Value=5.8e-08)        27   8.0  

>SB_28264| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +1

Query: 202 FPLSIDRKSLGP--TFRYIIKYNKI*YTHFTLYMNYN 306
           F L+++  +L P  T  +++ Y  I YT+F L M+YN
Sbjct: 17  FILTVNLNALAPIVTMPFLVTYAAIEYTYFKLAMSYN 53


>SB_31840| Best HMM Match : RuvA_N (HMM E-Value=5.6)
          Length = 895

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = -3

Query: 460 KCRCELYRSSPGSRCLLASFVQIPSASGTKDVVT*FTAHHVDCNSLCSRNCYYSS 296
           +CR  +   +     LL S+ Q+ SA   ++++  F   H D N   SR C  +S
Sbjct: 395 QCRELVIHQARSWELLLPSYKQVYSALHPRNLLKIFIKPHADANCSLSRGCSEAS 449


>SB_24073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 794

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = -3

Query: 412 LASFVQIPSASGTKDVVT*FTAHHVDCNSLCSRNCYYSSY 293
           L  F +I    G +DV+     HH  C+ LC RN +  +Y
Sbjct: 752 LGEFTEILEKIGRRDVIHEIENHHRTCH-LCIRNSFDFTY 790


>SB_24193| Best HMM Match : Acetyltransf_1 (HMM E-Value=5.8e-08)
          Length = 281

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 7/17 (41%), Positives = 15/17 (88%)
 Frame = +1

Query: 283 FTLYMNYNNSYGYINCY 333
           F ++MNYN++YG+++ +
Sbjct: 57  FVVFMNYNDAYGFVSVF 73


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,740,583
Number of Sequences: 59808
Number of extensions: 340643
Number of successful extensions: 692
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 689
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1325051197
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).