SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      155   3e-38
SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             150   7e-37
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              150   7e-37
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         149   2e-36
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              147   5e-36
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             116   2e-26
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   2e-09
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          60   2e-09
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   7e-08
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 51   6e-07
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             38   0.005
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               38   0.008
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.54 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.54 
SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.71 
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.2  
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  30   1.2  
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      30   1.6  
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  30   1.6  
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        29   2.2  
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    29   2.2  
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       29   2.2  
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.2  
SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)                  29   2.9  
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    29   2.9  
SB_4468| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.8  
SB_2537| Best HMM Match : zf-C2HC5 (HMM E-Value=2.5e-28)               29   3.8  
SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 28   5.0  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_50741| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.8  
SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)                 27   8.8  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.8  
SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.8  

>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  155 bits (375), Expect = 3e-38
 Identities = 81/134 (60%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  101 bits (243), Expect = 3e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 161


>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  150 bits (364), Expect = 7e-37
 Identities = 80/134 (59%), Positives = 87/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  101 bits (243), Expect = 3e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 161


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  150 bits (364), Expect = 7e-37
 Identities = 78/134 (58%), Positives = 87/134 (64%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNSPAM 133



 Score =  103 bits (246), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVS 161


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  149 bits (360), Expect = 2e-36
 Identities = 79/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNSPAM 132



 Score =  101 bits (243), Expect = 3e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  147 bits (357), Expect = 5e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNSPAM 132



 Score =  101 bits (243), Expect = 3e-22
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  116 bits (278), Expect = 2e-26
 Identities = 52/60 (86%), Positives = 57/60 (95%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61



 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 30/34 (88%), Positives = 30/34 (88%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           EAQSKRG LTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +2

Query: 95   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 211
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +2

Query: 110  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 211
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +2

Query: 383  EEHPVLLTEAPLNPKATERKMTHIMF 460
            E+ PVLLTEAPLNPK    +M  +MF
Sbjct: 2144 EDFPVLLTEAPLNPKMNRERMVQLMF 2169


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 7/129 (5%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRH 262
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VG     +R+
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDEASQLRY 66

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             +               +  +    FG   S M+    P    VLLTE PLNP     K
Sbjct: 67  MLEVNYPMDNGIVRNWDDMKHVWDYTFG--ESKMN--IDPRNTKVLLTEPPLNPMKNREK 122

Query: 443 MTHIMFPKH 469
           M  +MF  +
Sbjct: 123 MIEVMFENY 131



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +1

Query: 208 SGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF-YNELGVAPR 384
           S + G    + L+   EA   R  L + YP+++GIV NWDDM+ +W +TF  +++ + PR
Sbjct: 44  SQKVGDIEVKDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPR 103

Query: 385 GTPSPAH*GSPQPQGHREK 441
            T          P  +REK
Sbjct: 104 NTKVLLTEPPLNPMKNREK 122


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +2

Query: 80  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 226
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 741


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -3

Query: 208 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 92
           MA  + D GE+G+ SI+S ETGLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +2

Query: 386 EHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           +HPVLLTEAPLNP+    K   + F + F  PA+
Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFF-ETFNVPAL 158


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI H IV +WD ME+ W    +  L   P
Sbjct: 289 EAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEP 329


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -1

Query: 183 GNTARGASSPAKPALHIPEPLSTT 112
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -1

Query: 183 GNTARGASSPAKPALHIPEPLSTT 112
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1867

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +2

Query: 374  SPPEEHPV-LLTEAPLNPKATERKMTHIMFPKHFTRPAIVPS 496
            SPP +  V +L+  P  P  ++RKMT + FP     P   P+
Sbjct: 1481 SPPRQRKVSVLSPNPERPIPSQRKMTSVTFPTEMFEPPPAPA 1522


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -1

Query: 183 GNTARGASSPAKPALHIPEPLSTT 112
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +2

Query: 389 HPVLLTEAPLNPKATERKMTHIMFPKH 469
           HP+L++EA  N +    K+T +MF K+
Sbjct: 34  HPLLMSEAAWNTRIKREKLTELMFEKY 60


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 224 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTFYNE 366
           P + G + NWD  ++IW +TF  E
Sbjct: 292 PFQKGFLVNWDVEKQIWDYTFGKE 315



 Score = 27.9 bits (59), Expect = 6.6
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAV 178
           ++A LV+D G+   K GFA + APR++
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 419 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 282 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 260 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295


>SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 402

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 136 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171


>SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)
          Length = 635

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +1

Query: 178 VPLDRGKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNW--DDMEKIWHH 351
           V L +     +GR+   G+   +CR +A      +TL + I  G+  +   D  EK+W+H
Sbjct: 441 VTLSQNVVSVTGREESGGSGTQVCRKKAP----LITLSHVIRMGLALSLVSDVKEKVWYH 496

Query: 352 TFYN 363
           T  N
Sbjct: 497 TCPN 500


>SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)
          Length = 570

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = -3

Query: 241 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 131
           ++LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 184 IVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219


>SB_4468| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1513

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%)
 Frame = -2

Query: 260 ASLLHKSPSVPYRPSRPD---GGAFPRSRGTRREEHH 159
           ASL H++PS P  P  P     G F  + G +R  +H
Sbjct: 618 ASLSHETPSTPQTPRSPTSSMSGPFDNAFGRKRSPYH 654


>SB_2537| Best HMM Match : zf-C2HC5 (HMM E-Value=2.5e-28)
          Length = 523

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = -1

Query: 570 KSKPRIPGWVTAPKRCKSKKHGLNADGTMAGRVKC 466
           +S  R+PG    P  C  +KHGL  + T  GR+ C
Sbjct: 122 RSSVRLPG--RHPCECLGQKHGLVNNCTSCGRIVC 154


>SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 1197

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +2

Query: 404 TEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPC 511
           ++ PL+    + K   ++ P  FT+P+I P+  K C
Sbjct: 40  SQQPLSVHPVQGKERALILPHRFTKPSICPALRKKC 75


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -1

Query: 183 GNTARGASSPAKPALHIPEPLSTT 112
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -1

Query: 183 GNTARGASSPAKPALHIPEPLSTT 112
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1409

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 3/50 (6%)
 Frame = -3

Query: 502  ECRRN---NGGACKMFWKHDMGHLSLCGLGVEGSLSEQDWVFLGGRHPAH 362
            EC  N   NGG CK   +H  G+  +C  G  G   EQD     G +P H
Sbjct: 1195 ECSTNPCQNGGVCKN--EHG-GYSCVCKAGFTGKNCEQDVDECAGVNPCH 1241


>SB_50741| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +3

Query: 489 FRRHSNRASCFYTVSGPLPNPGFEAWTFRGEQG 587
           FRR +    C+ T +  +P+P F+AWT    +G
Sbjct: 454 FRRQN---CCWPTATPSIPDPAFDAWTDSAAEG 483


>SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 334

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -2

Query: 317 VTIPCSMGYLRVRKPLLLCASLLHKSPSVP 228
           V  PC M  LRVR     C S+LH   + P
Sbjct: 60  VACPCCMSLLRVRVVCPCCMSVLHVRVACP 89


>SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)
          Length = 186

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 2/77 (2%)
 Frame = -2

Query: 347 CQIFSMSSQLVTIPCSMG--YLRVRKPLLLCASLLHKSPSVPYRPSRPDGGAFPRSRGTR 174
           C    +  ++V   CS    Y+ V   +  C  + H+       PSR D   FP +   R
Sbjct: 102 CSCRCVPHRMVMSMCSPSRVYVDVSPIVCSCRCVPHRVLMSMCSPSRADVDVFPITCSRR 161

Query: 173 REEHHLLRNRPCTYRSH 123
              HH+L +   + R+H
Sbjct: 162 CVFHHVLMSMCSSSRAH 178


>SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = -1

Query: 198 LPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 88
           L  IE +    A++P  P + +P+ +   +AAT +SH
Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258


>SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 617

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -2

Query: 254 LLHKSPSVPYRPS--RPDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLLPT 108
           LL +S   P +P+  RP GGA P++    ++   +  N+  T+      PT
Sbjct: 92  LLDESTEAPPQPATIRPQGGALPQTPVKGKQNKRVSDNKEFTHAMQARRPT 142


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,062,131
Number of Sequences: 59808
Number of extensions: 596428
Number of successful extensions: 1704
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1496
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1696
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1451595000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).