SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      151   3e-37
SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             147   8e-36
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              147   8e-36
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         145   2e-35
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              144   5e-35
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             128   3e-30
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   2e-09
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          60   2e-09
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 52   4e-07
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               47   1e-05
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  41   0.001
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             36   0.021
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.26 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.59 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.59 
SB_12978| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.8e-24)          31   0.78 
SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)                 31   1.0  
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.4  
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      30   1.4  
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  30   1.4  
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_32977| Best HMM Match : Gp-FAR-1 (HMM E-Value=2.5)                  30   1.8  
SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)                 30   1.8  
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        30   1.8  
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    30   1.8  
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   1.8  
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   1.8  
SB_35162| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    29   2.4  
SB_33615| Best HMM Match : PA (HMM E-Value=9e-16)                      29   3.2  
SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                29   4.2  
SB_24277| Best HMM Match : EGF (HMM E-Value=2.4e-06)                   29   4.2  
SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)                  29   4.2  
SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                29   4.2  
SB_35006| Best HMM Match : PT (HMM E-Value=3.4)                        28   5.5  
SB_34469| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_30534| Best HMM Match : EGF (HMM E-Value=0.12)                      28   5.5  
SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22)                 28   5.5  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10)                   28   7.3  
SB_22098| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.3  
SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)                    27   9.7  
SB_24276| Best HMM Match : Extensin_2 (HMM E-Value=2.1e-05)            27   9.7  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              27   9.7  
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.7  
SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_26826| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)                   27   9.7  
SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)                 27   9.7  
SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)                 27   9.7  
SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              27   9.7  
SB_3036| Best HMM Match : Metallothionein (HMM E-Value=0.81)           27   9.7  

>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  151 bits (367), Expect = 3e-37
 Identities = 78/131 (59%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  147 bits (356), Expect = 8e-36
 Identities = 77/131 (58%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  147 bits (356), Expect = 8e-36
 Identities = 75/131 (57%), Positives = 82/131 (62%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN+P
Sbjct: 121 TQIMFETFNSP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  145 bits (352), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFN+P
Sbjct: 122 IMFETFNSP 130



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  144 bits (349), Expect = 5e-35
 Identities = 75/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFN+P
Sbjct: 122 IMFETFNSP 130



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  128 bits (310), Expect = 3e-30
 Identities = 58/61 (95%), Positives = 61/61 (100%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 R 254
           R
Sbjct: 62  R 62



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 24/30 (80%), Positives = 26/30 (86%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTF 337
           ++ ILTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIMFETF 90


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++ + +L + YP+++GIV NWDDM+ +W +TF  +++ + P    VLLTE  LNP  NRE
Sbjct: 62  SQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNPMKNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 43/139 (30%), Positives = 61/139 (43%), Gaps = 3/139 (2%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRV 257
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VGDEA   R 
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDEASQLRY 66

Query: 258 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVS-PPRNTQSCLLRLPSTPRATERKMTQI 434
                              +         S ++  PRNT+  L   P  P     KM ++
Sbjct: 67  MLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNPMKNREKMIEV 126

Query: 435 MFETFNTPRHVRLAFKPVL 491
           MFE +     V +A + VL
Sbjct: 127 MFENYQF-EGVYIAIQAVL 144


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +3

Query: 75   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 191
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +3

Query: 90   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 191
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130



 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 22/35 (62%), Positives = 27/35 (77%)
 Frame = +2

Query: 317  KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
            K+W H F ++LRV  E+ PVLLTEA LNPK NRE+
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRER 2163



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +3

Query: 381  LLRLPSTPRATERKMTQIMFETFNTP 458
            L   P  P+    +M Q+MFE+FN P
Sbjct: 2150 LTEAPLNPKMNRERMVQLMFESFNVP 2175


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 3/67 (4%)
 Frame = +3

Query: 60  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYV 230
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKY 752

Query: 231 GDEAQSK 251
           GD A +K
Sbjct: 753 GDAAVAK 759


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +2

Query: 269 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASL 397
           K+PI H IV +WD ME+ W    +  LR  PE+H  LL   +L
Sbjct: 299 KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLLAVLAL 341


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -3

Query: 188 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 72
           MA  + D GE+G+ SI+S ETGLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA+ N +  REK
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREK 51


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 36.3 bits (80), Expect = 0.021
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +2

Query: 365 EHPVLLTEASLNPKGNREK 421
           +HPVLLTEA LNP+ NREK
Sbjct: 126 QHPVLLTEAPLNPRRNREK 144



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L   P  PR    K  ++ FETFN P
Sbjct: 131 LTEAPLNPRRNREKAAEVFFETFNVP 156


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%)
 Frame = +2

Query: 191 GRDGRYGTEGLLCRR*-GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-- 361
           GR G   + GL      G+ +     L+ P +  +VT+++  E++  H F +     P  
Sbjct: 105 GRKGEPDSGGLAVGNDIGSVEMIRWALRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGG 164

Query: 362 EEHPVLLTEASLNPKGNREKDDPDH 436
             HPV++TE   NP   R+ +  +H
Sbjct: 165 VNHPVIMTEPVCNPNYCRQCEHFNH 189


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -1

Query: 163 GNTARGASSPAKPALHIPEPLSTT 92
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -1

Query: 163 GNTARGASSPAKPALHIPEPLSTT 92
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_12978| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.8e-24)
          Length = 1592

 Score = 31.1 bits (67), Expect = 0.78
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -1

Query: 400  VEGSLSKQDWVFLGGDTQLIVEGMMPNLLHVI 305
            +  SL+KQ+W +   D Q+IVEG M N  ++I
Sbjct: 1329 IRQSLTKQEWRWQMDDPQMIVEGAMQNHYNMI 1360


>SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)
          Length = 186

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 2/91 (2%)
 Frame = -2

Query: 369 CSSGATRSSL*KV*CQIFSMSSQLVTIPCSMG--YLRVRILFCSVPHLLHKSPSVPYRPS 196
           CS       +  + C    +  ++V   CS    Y+ V  + CS   + H+       PS
Sbjct: 88  CSPSRAHVDVFPITCSCRCVPHRMVMSMCSPSRVYVDVSPIVCSCRCVPHRVLMSMCSPS 147

Query: 195 RPDGGAFPRSRGTRREEHHLLRNRPCTYRSH 103
           R D   FP +   R   HH+L +   + R+H
Sbjct: 148 RADVDVFPITCSRRCVFHHVLMSMCSSSRAH 178


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -1

Query: 163 GNTARGASSPAKPALHIPEPLSTT 92
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 216 ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +2

Query: 254 SILTLKYPIEHGIVTNWDDMEKIWHHTFYNE 346
           S L    P + G + NWD  ++IW +TF  E
Sbjct: 285 SALFYVLPFQKGFLVNWDVEKQIWDYTFGKE 315



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAV 158
           ++A LV+D G+   K GFA + APR++
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 411 ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454


>SB_32977| Best HMM Match : Gp-FAR-1 (HMM E-Value=2.5)
          Length = 402

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = +2

Query: 461 PCTFGIQARASRCTPSVRTTRYSCWDFPGTGVFPQP-VPHFTERDTPLFPH 610
           PCT   + R++ CTP  +    SC   P T     P  PH  +R T   PH
Sbjct: 316 PCTPHTKDRSTPCTPHTKDRSTSC--TPHTKDRSTPCTPHTKDRSTSCTPH 364


>SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)
          Length = 892

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 5/72 (6%)
 Frame = -3

Query: 251 FALCLISYI--RVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQR 87
           FA CL   +   V+LSH + H L A       +HG R+  SCET L    H  A +  + 
Sbjct: 462 FATCLACKVMKHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKH 520

Query: 86  GNFFVAHLELVK 51
           G   V  L+  K
Sbjct: 521 GQVDVLLLDFQK 532


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 274 ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 252 ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295


>SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 94  ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 402

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 94  ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 128 ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171


>SB_35162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 317

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -3

Query: 527 NTGWYGRKAYSEKHGLECQT--YMAGRVKCFEHDL 429
           N  W+  +  +EK  L C+T  Y+A R   + HDL
Sbjct: 32  NKNWFDLECDTEKENLRCETGLYLAQRCYLYVHDL 66


>SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)
          Length = 570

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 17/45 (37%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 176 ICCKVMEHIVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219


>SB_33615| Best HMM Match : PA (HMM E-Value=9e-16)
          Length = 629

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 562 WKNTGSREVPAR-IPGGTDGRRTARSTGLNAKRTWRGVLNVS 440
           +K +G   +PA+ I  G   +  +R  GL   + WRG LN+S
Sbjct: 169 YKGSGLPSIPAQPISYGEAAQILSRMGGLAVPKEWRGSLNIS 210


>SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 3804

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 25/70 (35%), Positives = 31/70 (44%), Gaps = 9/70 (12%)
 Frame = -1

Query: 610  VGEKWG-IPFGKMGH-GLWKNTGSREVP------ARIPGGTDGRRTA-RSTGLNAKRTWR 458
            V + WG    G++ H G W++TG R +P      A I G    RR A R   L A R   
Sbjct: 2705 VDKLWGNCAGGRVEHLGCWRDTGRRAIPQLDGKFALIRGNYQRRRNAIRRCALVAARLGY 2764

Query: 457  GVLNVSNMIW 428
             V  V N  W
Sbjct: 2765 RVFGVQNGGW 2774



 Score = 27.5 bits (58), Expect = 9.7
 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 9/70 (12%)
 Frame = -1

Query: 610 VGEKWG-IPFGKMGH-GLWKNTGSREVP------ARIPGGTDGRRTA-RSTGLNAKRTWR 458
           V + WG    G + H G W++TG R +P      A I G    RR A R   L A R   
Sbjct: 352 VDKLWGNCAGGAVEHLGCWRDTGRRAIPQLDGKFALIRGNYQRRRNAIRRCALVAARLGY 411

Query: 457 GVLNVSNMIW 428
            V  V N  W
Sbjct: 412 RVFGVQNGGW 421


>SB_24277| Best HMM Match : EGF (HMM E-Value=2.4e-06)
          Length = 433

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 6/93 (6%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPR----ATERKMTQIMFETFNTPRHVRLAFK--PVLLAVRLPSV 515
           S P   +  +   P+ P+    +T      IM  T N P+ +  +    P  +   LP+ 
Sbjct: 274 STPNPPKGIMGSTPNPPKGIMGSTPNPPKGIMGSTPNPPKGIMGSTPNPPKRIMGSLPNP 333

Query: 516 PPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
           P GI   T   P       P  PKGI   +P P
Sbjct: 334 PKGIMGSTPNPPKEIMGSTPNPPKGIMGSTPNP 366



 Score = 27.5 bits (58), Expect = 9.7
 Identities = 14/37 (37%), Positives = 16/37 (43%)
 Frame = +3

Query: 504 LPSVPPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
           LP+ P GI   T   P       P  PKGI   +P P
Sbjct: 220 LPNPPKGIMGSTPNPPKGIMGSTPNPPKGIMGSTPNP 256



 Score = 27.5 bits (58), Expect = 9.7
 Identities = 14/37 (37%), Positives = 16/37 (43%)
 Frame = +3

Query: 504 LPSVPPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
           LP+ P GI   T   P       P  PKGI   +P P
Sbjct: 396 LPNPPKGIMGSTPNPPKGIMGSTPNPPKGIMGSTPNP 432


>SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)
          Length = 635

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 158 VPLDRGKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNW--DDMEKIWHH 331
           V L +     +GR+   G+   +CR+    +  ++TL + I  G+  +   D  EK+W+H
Sbjct: 441 VTLSQNVVSVTGREESGGSGTQVCRK----KAPLITLSHVIRMGLALSLVSDVKEKVWYH 496

Query: 332 TFYN 343
           T  N
Sbjct: 497 TCPN 500


>SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 4002

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 25/70 (35%), Positives = 31/70 (44%), Gaps = 9/70 (12%)
 Frame = -1

Query: 610  VGEKWG-IPFGKMGH-GLWKNTGSREVP------ARIPGGTDGRRTA-RSTGLNAKRTWR 458
            V + WG    G++ H G W++TG R +P      A I G    RR A R   L A R   
Sbjct: 802  VDKLWGNCAGGRVQHLGCWRDTGRRAIPQLDGKFALIRGNYQRRRNAIRRCALVAARLGY 861

Query: 457  GVLNVSNMIW 428
             V  V N  W
Sbjct: 862  RVFGVQNGGW 871


>SB_35006| Best HMM Match : PT (HMM E-Value=3.4)
          Length = 325

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = -1

Query: 283 FDGVFEGQDTLLLCASSPT*ESFCPIPTITP*WRGLPT 170
           +DGV + +  LLL +SSP   S  PI   TP  +GL T
Sbjct: 273 YDGVIDIKLNLLLLSSSPMFLSAVPIAPHTPTLQGLHT 310


>SB_34469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 444

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 18/47 (38%), Positives = 20/47 (42%)
 Frame = -3

Query: 629 NRQGNGRGGKVGYPFR*NGARVVEKHRFPGSPSTNTGWYGRKAYSEK 489
           NR   G GGKV Y F        E        +TNT W+  K  SEK
Sbjct: 215 NRATGGVGGKVSYKFN------YESSSTTTDTNTNTQWFIDKVMSEK 255


>SB_30534| Best HMM Match : EGF (HMM E-Value=0.12)
          Length = 521

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +3

Query: 504 LPSVPPGIRAGTSREPVFFHNPCPILPKG 590
           LP+  P I  G S +PV  +NP P++  G
Sbjct: 442 LPASKPIIAVGVSGDPVNGNNPSPVIANG 470


>SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22)
          Length = 1421

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +3

Query: 333 PSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLA 476
           PS++S  SPP N+  C+    +   ++ +  + +   TF   RH   A
Sbjct: 598 PSSLSSPSPPPNSPFCIFDYETIGHSSYKHASAVTMGTFPNYRHAARA 645


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -1

Query: 163 GNTARGASSPAKPALHIPEPLSTT 92
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -1

Query: 163 GNTARGASSPAKPALHIPEPLSTT 92
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10)
          Length = 968

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 24/81 (29%), Positives = 31/81 (38%), Gaps = 2/81 (2%)
 Frame = +3

Query: 351  VSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP-RHVRLAFKPVLLAVRLPSVP-PG 524
            V+P  +TQ      P TP  T+R+ T     +  TP R V             PS P P 
Sbjct: 764  VNPRLHTQYTHTYTPGTPTPTQREYTHAYTPSTPTPTRPVHPRLHTEYTHAYTPSTPSPT 823

Query: 525  IRAGTSREPVFFHNPCPILPK 587
             R  T     + H   PI P+
Sbjct: 824  HRVHTRLHTKYTHAYTPIHPR 844


>SB_22098| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 976

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +3

Query: 399 TPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPSVPP 521
           +P++T      +MF      R    A KP  + V  P++PP
Sbjct: 359 SPKSTAAMARDVMFGKMTPERFAAKACKPTEMRVTRPNIPP 399


>SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)
          Length = 419

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 245 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 288


>SB_24276| Best HMM Match : Extensin_2 (HMM E-Value=2.1e-05)
          Length = 449

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 14/37 (37%), Positives = 16/37 (43%)
 Frame = +3

Query: 504 LPSVPPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
           LP+ P GI   T   P       P  PKGI   +P P
Sbjct: 202 LPNPPKGIMGSTPNPPKGIMGSTPNPPKGIMGSTPNP 238


>SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = -1

Query: 178 LPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 68
           L  IE +    A++P  P + +P+ +   +AAT +SH
Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258


>SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 106 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 149


>SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2396

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245  LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
            +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 1644 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 1687


>SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 859

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 672 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 715


>SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3142

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           LC  +   ++LSH + H L         +HG R  +SCET L  T
Sbjct: 857 LCCKTMEHIVLSHLNKH-LSRFNILSNAQHGFRQGLSCETQLVLT 900


>SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 617

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -2

Query: 234 LLHKSPSVPYRPS--RPDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLLPT 88
           LL +S   P +P+  RP GGA P++    ++   +  N+  T+      PT
Sbjct: 92  LLDESTEAPPQPATIRPQGGALPQTPVKGKQNKRVSDNKEFTHAMQARRPT 142


>SB_26826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 221

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/57 (31%), Positives = 25/57 (43%)
 Frame = -2

Query: 240 PHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLLPTRQLLRR 70
           P  L  +P +  RPS      +  S  +      LL  RP TYR+   LP+  LL +
Sbjct: 131 PLYLPSAPLLTERPSTYRAPLYLPSAPSTYRAPLLLTERPSTYRAPLYLPSTPLLTK 187


>SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)
          Length = 329

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 227 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 270


>SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)
          Length = 1492

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245  LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
            +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 1082 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 1125


>SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)
          Length = 452

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 25  ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 68


>SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 245 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           +C      ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 106 ICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 149


>SB_3036| Best HMM Match : Metallothionein (HMM E-Value=0.81)
          Length = 597

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = -1

Query: 559 KNTGSREVPARIPGGT--DGRRTARSTGLNAKRTWRGVLNVSNM 434
           ++  +R +P    G +  + R+T+ S G+N    W GV+  +N+
Sbjct: 505 RSARARPLPTHRSGNSRPNSRKTSNSEGVNTVNNWTGVVFCNNL 548


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,639,037
Number of Sequences: 59808
Number of extensions: 639465
Number of successful extensions: 2116
Number of sequences better than 10.0: 59
Number of HSP's better than 10.0 without gapping: 1817
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2098
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1596754500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).