SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33)                   29   2.9  
SB_59742| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.9  
SB_43261| Best HMM Match : TSP_1 (HMM E-Value=0.0026)                  27   8.9  
SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0)                        27   8.9  
SB_4637| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   8.9  

>SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 542

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +1

Query: 142 ALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYIPW 258
           ALIP       +E  R K+  S+PR R  I  +LN IP+
Sbjct: 18  ALIPGGVKSTLLENLREKVDKSIPRDRHSIAESLNQIPY 56


>SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33)
          Length = 958

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +3

Query: 6   SEVFSFLWARFTSISNDKAPRNILVERGRLELPGP 110
           SE   FLWA     +ND+  R +    GR   P P
Sbjct: 459 SECIKFLWAALAQFTNDERSRFLRFVTGRRRPPAP 493


>SB_59742| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 390

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -3

Query: 422 CRIHKCQTSKYPKTITLVCFDPCIQKS 342
           C+   C TSK+  T T VC D  I K+
Sbjct: 130 CKNGTCHTSKHDDTYTCVCDDGAIGKN 156


>SB_43261| Best HMM Match : TSP_1 (HMM E-Value=0.0026)
          Length = 649

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%)
 Frame = -1

Query: 367 ALTPVYRSQSCFDNLPNSLPSKLG*GVNFGDGSYGASR---ECSSK 239
           A+   Y +Q C DN       K G G N+ +  Y   +   +CS+K
Sbjct: 256 AIEETYNTQGCNDNCERCSDGKFGAGTNWSNFIYRVKKDWTDCSAK 301


>SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0)
          Length = 684

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%)
 Frame = -1

Query: 367 ALTPVYRSQSCFDNLPNSLPSKLG*GVNFGDGSYGASR---ECSSK 239
           A+   Y +Q C DN       K G G N+ +  Y   +   +CS+K
Sbjct: 115 AIEETYNTQGCNDNCERCSDGKFGAGTNWSNFIYRVKKDWTDCSAK 160


>SB_4637| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +3

Query: 198 VRQRS*VALRYSSYFELHSLDAPYEPSPKLTPYPSFEGNELGKLSKQ 338
           +  R+   + YS YF L+ +      SPK+T   S +    GKL K+
Sbjct: 5   IEDRTGPKISYSRYFSLNDIRHSPASSPKVTRAVSLQRISEGKLKKK 51


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,190,182
Number of Sequences: 59808
Number of extensions: 426570
Number of successful extensions: 1194
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1120
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1194
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1475788250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).