BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30158 (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 27 0.46 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 27 0.46 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 24 4.3 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 5.7 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 24 5.7 DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. 23 9.9 AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. 23 9.9 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 27.5 bits (58), Expect = 0.46 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = -1 Query: 382 KARWSSILRFSSSAIFSCISMLGEPTIVITSSLKYLRKSSNQYLTILPLNLEDLFEDSYE 203 +AR + L + IFS +S L EP VI S Y +++ LED D Y Sbjct: 95 RARVHTALHLEAGVIFSRLSFLFEP--VIYSGKSYFHSDRIEHIRKAYRLLEDSLVDQYM 152 Query: 202 I 200 + Sbjct: 153 V 153 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 27.5 bits (58), Expect = 0.46 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = -1 Query: 382 KARWSSILRFSSSAIFSCISMLGEPTIVITSSLKYLRKSSNQYLTILPLNLEDLFEDSYE 203 +AR + L + IFS +S L EP VI S Y +++ LED D Y Sbjct: 95 RARVHTALHLEAGVIFSRLSFLFEP--VIYSGKSYFHSDRIEHIRKAYRLLEDSLVDQYM 152 Query: 202 I 200 + Sbjct: 153 V 153 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -3 Query: 584 ISKVRASLPPPLLQVEDGVTLEGI 513 I+++ A+ PPPL + G+ +EG+ Sbjct: 330 IAQMCAAPPPPLHAINRGIGIEGL 353 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -3 Query: 125 SRLAALSRSCFCSSLSKRTMSMGSPPLRTCS 33 S +++ SC S+LS++ ++ +PP+ S Sbjct: 673 SLMSSARESCGASALSRKLLTESAPPIAPMS 703 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +1 Query: 136 HQAIAFRCIGDSLYSQNEQDFISRMNPQKDLQDLMEESSDTGWNFYVNIL 285 H + F I S+Y + + + ++NPQ + L+ ++ W Y ++ Sbjct: 21 HLGLEFNHIVTSIYDPADFEVLKKVNPQHTIPTLV-DNGHILWESYAILI 69 >DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. Length = 144 Score = 23.0 bits (47), Expect = 9.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +2 Query: 62 STWSVWRDYCRNNSGRARPAL 124 + W+ W+D CR G+ +P++ Sbjct: 119 NAWNAWKDKCR---GKPKPSV 136 >AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. Length = 144 Score = 23.0 bits (47), Expect = 9.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +2 Query: 62 STWSVWRDYCRNNSGRARPAL 124 + W+ W+D CR G+ +P++ Sbjct: 119 NAWNAWKDKCR---GKPKPSV 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,359 Number of Sequences: 2352 Number of extensions: 14592 Number of successful extensions: 45 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -