BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30154 (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341209-1|AAR13773.1| 196|Anopheles gambiae SP14D1 protein. 26 0.55 AY341208-1|AAR13772.1| 196|Anopheles gambiae SP14D1 protein. 26 0.55 AY341207-1|AAR13771.1| 196|Anopheles gambiae SP14D1 protein. 26 0.55 AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. 26 0.55 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 26 0.55 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 5.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 5.1 AY330181-1|AAQ16287.1| 156|Anopheles gambiae odorant-binding pr... 23 5.1 AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding pr... 23 6.8 AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 23 6.8 >AY341209-1|AAR13773.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 26.2 bits (55), Expect = 0.55 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 250 LPASEHLRNAPHAGEAGHRGTW-KTSSLS 333 LP S LRN HAG + + W KT + S Sbjct: 70 LPLSNSLRNRKHAGLSSYAAGWGKTETAS 98 >AY341208-1|AAR13772.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 26.2 bits (55), Expect = 0.55 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 250 LPASEHLRNAPHAGEAGHRGTW-KTSSLS 333 LP S LRN HAG + + W KT + S Sbjct: 70 LPLSNSLRNRKHAGLSSYAAGWGKTETAS 98 >AY341207-1|AAR13771.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 26.2 bits (55), Expect = 0.55 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 250 LPASEHLRNAPHAGEAGHRGTW-KTSSLS 333 LP S LRN HAG + + W KT + S Sbjct: 70 LPLSNSLRNRKHAGLSSYAAGWGKTETAS 98 >AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 26.2 bits (55), Expect = 0.55 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 250 LPASEHLRNAPHAGEAGHRGTW-KTSSLS 333 LP S LRN HAG + + W KT + S Sbjct: 70 LPLSNSLRNRKHAGLSSYAAGWGKTETAS 98 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 26.2 bits (55), Expect = 0.55 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 250 LPASEHLRNAPHAGEAGHRGTW-KTSSLS 333 LP S LRN HAG + + W KT + S Sbjct: 234 LPLSNSLRNRKHAGLSSYAAGWGKTETAS 262 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 5.1 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 441 PNPLSIGFFVTQNSRG-PHFAKIPPFLIRKHACCSP 337 P S+ + + S G PH P L H+C SP Sbjct: 148 PGTSSVPLTIHRRSPGVPHHVAEPQHLGATHSCVSP 183 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 5.1 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 441 PNPLSIGFFVTQNSRG-PHFAKIPPFLIRKHACCSP 337 P S+ + + S G PH P L H+C SP Sbjct: 148 PGTSSVPLTIHRRSPGVPHHVAEPQHLGATHSCVSP 183 >AY330181-1|AAQ16287.1| 156|Anopheles gambiae odorant-binding protein AgamOBP55 protein. Length = 156 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 347 VALRRLNDDVFQVPRCPASPAWGAFRRC 264 + +R+N+++ +V R SP F RC Sbjct: 109 IIAKRMNNNIAEVNRMRCSPLPYLFNRC 136 >AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding protein AgamOBP35 protein. Length = 277 Score = 22.6 bits (46), Expect = 6.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 269 RCSEAGRV*GRVLGETDCYQH 207 RC A V + G TD Y+H Sbjct: 242 RCEHATDVFSQCFGNTDLYKH 262 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 22.6 bits (46), Expect = 6.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 269 RCSEAGRV*GRVLGETDCYQH 207 RC A V + G TD Y+H Sbjct: 242 RCEHATDVFSQCFGNTDLYKH 262 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 464,164 Number of Sequences: 2352 Number of extensions: 7928 Number of successful extensions: 21 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -