SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ437578-1|ABD96048.1|  234|Anopheles gambiae short neuropeptide...    25   2.1  
X87410-1|CAA60857.1|  498|Anopheles gambiae maltase-like protein...    24   6.5  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    24   6.5  
AY146745-1|AAO12105.1|  153|Anopheles gambiae odorant-binding pr...    24   6.5  
AJ697725-1|CAG26918.1|  153|Anopheles gambiae putative odorant-b...    24   6.5  
AF437886-1|AAL84181.1|  153|Anopheles gambiae odorant binding pr...    24   6.5  
AY146733-1|AAO12093.1|  131|Anopheles gambiae odorant-binding pr...    23   8.6  
AJ697724-1|CAG26917.1|  131|Anopheles gambiae putative odorant-b...    23   8.6  

>DQ437578-1|ABD96048.1|  234|Anopheles gambiae short neuropeptide F
           prepropeptide protein.
          Length = 234

 Score = 25.4 bits (53), Expect = 2.1
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 397 RPAVRI-GRRMHHPGSGRPRPALRPVQEGRLP---LRQVALLLKIGRNTPSYQAIQENA 561
           R AVR    R+       P   LRP ++  +    +R   L L+ GRN P + +  ENA
Sbjct: 57  RKAVRSPSLRLRFGRRSDPSVPLRPEEDELIDQKAIRAPQLRLRFGRNDPLWTSFNENA 115


>X87410-1|CAA60857.1|  498|Anopheles gambiae maltase-like protein
           Agm1 protein.
          Length = 498

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +1

Query: 166 PPVQWESVCRTSAW 207
           PP  W SV R SAW
Sbjct: 159 PPSNWVSVFRGSAW 172


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 13/33 (39%), Positives = 13/33 (39%)
 Frame = +1

Query: 334 ASGLPAGEEGHHPRHQGRQGCRPAVRIGRRMHH 432
           ASG P G  GHH  H    G   A       HH
Sbjct: 697 ASGSPYGGGGHHLSHH-HGGAAAATGHHHHQHH 728


>AY146745-1|AAO12105.1|  153|Anopheles gambiae odorant-binding
           protein AgamOBP3 protein.
          Length = 153

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +3

Query: 78  YPTPELQEELKKIAQAIVA 134
           YP PEL E++K +  A VA
Sbjct: 38  YPPPELLEKMKPMHDACVA 56


>AJ697725-1|CAG26918.1|  153|Anopheles gambiae putative
           odorant-binding protein OBPjj15 protein.
          Length = 153

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +3

Query: 78  YPTPELQEELKKIAQAIVA 134
           YP PEL E++K +  A VA
Sbjct: 38  YPPPELLEKMKPMHDACVA 56


>AF437886-1|AAL84181.1|  153|Anopheles gambiae odorant binding
           protein protein.
          Length = 153

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +3

Query: 78  YPTPELQEELKKIAQAIVA 134
           YP PEL E++K +  A VA
Sbjct: 38  YPPPELLEKMKPMHDACVA 56


>AY146733-1|AAO12093.1|  131|Anopheles gambiae odorant-binding
           protein AgamOBP23 protein.
          Length = 131

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 6/19 (31%), Positives = 13/19 (68%)
 Frame = +2

Query: 440 LDDLAQRCAQYKKDGCHFA 496
           +D++ ++C + K+D C  A
Sbjct: 99  IDEMLEKCGEQKEDACETA 117


>AJ697724-1|CAG26917.1|  131|Anopheles gambiae putative
           odorant-binding protein OBPjj14 protein.
          Length = 131

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 6/19 (31%), Positives = 13/19 (68%)
 Frame = +2

Query: 440 LDDLAQRCAQYKKDGCHFA 496
           +D++ ++C + K+D C  A
Sbjct: 99  IDEMLEKCGEQKEDACETA 117


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 922,834
Number of Sequences: 2352
Number of extensions: 22042
Number of successful extensions: 75
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 70
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 87734433
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).