SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    46   9e-07
AJ618928-1|CAF02007.1|  285|Anopheles gambiae odorant-binding pr...    26   1.0  
Y17688-1|CAA76813.1|  153|Anopheles gambiae gSG1 protein protein.      25   3.2  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            25   3.2  
AJ130949-1|CAA10258.1|  401|Anopheles gambiae SG1 protein protein.     25   3.2  
Z22930-6|CAA80518.1|  277|Anopheles gambiae trypsin protein.           24   4.2  
Z18890-1|CAA79328.1|  277|Anopheles gambiae trypsin protein.           24   4.2  
AY146757-1|AAO12072.1|  246|Anopheles gambiae odorant-binding pr...    24   4.2  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            24   5.5  
AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          24   5.5  
AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger transc...    24   5.5  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    23   7.3  
AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR ...    23   7.3  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   9.6  
EF426224-1|ABO26467.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426223-1|ABO26466.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426222-1|ABO26465.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426221-1|ABO26464.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426220-1|ABO26463.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426219-1|ABO26462.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426218-1|ABO26461.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426217-1|ABO26460.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426216-1|ABO26459.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426215-1|ABO26458.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426214-1|ABO26457.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426213-1|ABO26456.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426212-1|ABO26455.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426211-1|ABO26454.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426210-1|ABO26453.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426209-1|ABO26452.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426208-1|ABO26451.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426207-1|ABO26450.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426206-1|ABO26449.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426205-1|ABO26448.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426204-1|ABO26447.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426203-1|ABO26446.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426201-1|ABO26444.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426199-1|ABO26442.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426198-1|ABO26441.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426197-1|ABO26440.1|   94|Anopheles gambiae unknown protein.         23   9.6  
EF426195-1|ABO26438.1|   94|Anopheles gambiae unknown protein.         23   9.6  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            23   9.6  
AY146739-1|AAO12099.1|  176|Anopheles gambiae odorant-binding pr...    23   9.6  

>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 46.4 bits (105), Expect = 9e-07
 Identities = 21/52 (40%), Positives = 35/52 (67%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           VE+F+   L+EE++  +    + KP+ IQ+ AI   + GRD++A AQ+G+GK
Sbjct: 173 VESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQTGSGK 224



 Score = 25.8 bits (54), Expect = 1.4
 Identities = 16/52 (30%), Positives = 23/52 (44%)
 Frame = +2

Query: 290 IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIR 445
           ++   R    +I+APTRELA QI             K     GGT V+  ++
Sbjct: 243 LELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKVCVSYGGTAVQHQLQ 294


>AJ618928-1|CAF02007.1|  285|Anopheles gambiae odorant-binding
           protein OBPjj83a protein.
          Length = 285

 Score = 26.2 bits (55), Expect = 1.0
 Identities = 17/65 (26%), Positives = 29/65 (44%)
 Frame = +3

Query: 114 DDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNKS 293
           D+      LL  ++  G +  S  ++RA + CI     + +AQ    +  + LYR +   
Sbjct: 215 DEQGPNIALLYSLFGAG-QSESEFRRRANL-CIDANQPLLEAQDKNAQAYVKLYRCFADQ 272

Query: 294 IQAFV 308
           I A V
Sbjct: 273 ISALV 277


>Y17688-1|CAA76813.1|  153|Anopheles gambiae gSG1 protein protein.
          Length = 153

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -2

Query: 630 LTNHLEDHQWIWSLENLWNNIFISF 556
           +T  L  +Q   S +NLW+N+ +SF
Sbjct: 30  VTRLLGPNQAALSCDNLWSNLLLSF 54


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 1/28 (3%)
 Frame = -2

Query: 606  QWIWSLENLWNNIFISFIKNKK-FDGVG 526
            +W WS    WN +FI  +     F+ VG
Sbjct: 2784 KWDWSQPGTWNALFIGSLTGASLFNAVG 2811


>AJ130949-1|CAA10258.1|  401|Anopheles gambiae SG1 protein protein.
          Length = 401

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -2

Query: 630 LTNHLEDHQWIWSLENLWNNIFISF 556
           +T  L  +Q   S +NLW+N+ +SF
Sbjct: 30  VTRLLGPNQAALSCDNLWSNLLLSF 54


>Z22930-6|CAA80518.1|  277|Anopheles gambiae trypsin protein.
          Length = 277

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = +2

Query: 59  GMDPGTLAHRLGSS 100
           G+DP +LA RLGSS
Sbjct: 95  GLDPSSLAVRLGSS 108


>Z18890-1|CAA79328.1|  277|Anopheles gambiae trypsin protein.
          Length = 277

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = +2

Query: 59  GMDPGTLAHRLGSS 100
           G+DP +LA RLGSS
Sbjct: 95  GLDPSSLAVRLGSS 108


>AY146757-1|AAO12072.1|  246|Anopheles gambiae odorant-binding
           protein AgamOBP39 protein.
          Length = 246

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 13/47 (27%), Positives = 22/47 (46%)
 Frame = +3

Query: 168 EKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNKSIQAFV 308
           +  S  ++RA + CI     + +AQ    +  + LYR +   I A V
Sbjct: 193 QSESEFRRRANL-CIDANQPLLEAQDKNAQAYVKLYRCFADQISALV 238


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 8/23 (34%), Positives = 10/23 (43%)
 Frame = -2

Query: 606  QWIWSLENLWNNIFISFIKNKKF 538
            +W WS    WN +F   I    F
Sbjct: 2783 KWDWSQPGTWNALFTGSISGASF 2805


>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +3

Query: 621 GWSADCFKSIFTLLLTMAWIECYLGSYRRWL 713
           GW A+  +   T+  T  WIE +L    +WL
Sbjct: 460 GWGAEYRRQ--TVTSTPCWIELHLNGPLQWL 488


>AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger
           transcription factor pannier protein.
          Length = 537

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH 426
           HH H HH P    L G+
Sbjct: 505 HHHHHHHHPTAADLAGY 521


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 52  TSGNGPWDTCTPTGIKLSKPSMT*TS 129
           T G GP    + +G + SKPS+T T+
Sbjct: 763 TGGGGPPPDGSGSGSRCSKPSVTSTT 788


>AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR
           protein.
          Length = 640

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 11/30 (36%), Positives = 13/30 (43%)
 Frame = -3

Query: 377 ELSPPSEFVGPALLWEPGSKLDIHECLYRF 288
           E SP S F G    W+ G       CL+ F
Sbjct: 394 ENSPKSAFTGRIEFWDGGRDFCFLICLFSF 423


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
            channel alpha1 subunit protein.
          Length = 1893

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +1

Query: 436  RYSPTGEWCSCTWWALQGRVYDMIIVVRFHANTIKL 543
            RY P        WW +  + ++ +I V    NTI L
Sbjct: 1157 RYIPKHRIQYKVWWFVTSQPFEYMIFVLIMINTITL 1192


>EF426224-1|ABO26467.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426223-1|ABO26466.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426222-1|ABO26465.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426221-1|ABO26464.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426220-1|ABO26463.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426219-1|ABO26462.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426218-1|ABO26461.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426217-1|ABO26460.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426216-1|ABO26459.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426215-1|ABO26458.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426214-1|ABO26457.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426213-1|ABO26456.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426212-1|ABO26455.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426211-1|ABO26454.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426210-1|ABO26453.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426209-1|ABO26452.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426208-1|ABO26451.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426207-1|ABO26450.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426206-1|ABO26449.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426205-1|ABO26448.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426204-1|ABO26447.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426203-1|ABO26446.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426201-1|ABO26444.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426199-1|ABO26442.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426198-1|ABO26441.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426197-1|ABO26440.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>EF426195-1|ABO26438.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI 212
           T DD + K+E   G  A  F K   +++ A  PC+
Sbjct: 60  TCDDPSPKQECAEGCKAGCFCKADHVRKHAGGPCV 94


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 6/17 (35%), Positives = 15/17 (88%)
 Frame = +2

Query: 251 WKTATFSISILQQIDTS 301
           WK++T +I +++Q+D++
Sbjct: 170 WKSSTSTIQLIEQLDSN 186


>AY146739-1|AAO12099.1|  176|Anopheles gambiae odorant-binding
           protein AgamOBP29 protein.
          Length = 176

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = +3

Query: 24  HRRIKVVTMDLREWTLGHLHTDWDQVVETFDDMNLKEEL 140
           H+ + V+T D+RE  L   +   D + E F  + L   L
Sbjct: 107 HKVLHVITKDIREHELREFYV--DSIQECFHMLGLDNRL 143


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 848,098
Number of Sequences: 2352
Number of extensions: 18357
Number of successful extensions: 84
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 79
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 84
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74012934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).