SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY028783-1|AAK32957.1|  499|Anopheles gambiae cytochrome P450 pr...    25   2.7  
AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.        24   6.2  

>AY028783-1|AAK32957.1|  499|Anopheles gambiae cytochrome P450
           protein.
          Length = 499

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 7/20 (35%), Positives = 16/20 (80%)
 Frame = +1

Query: 82  MASTATLIQPSGELWKKIRE 141
           +++  T+I+P G+LW K+++
Sbjct: 473 LSNAHTVIKPQGDLWLKVKK 492


>AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.
          Length = 615

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 3/92 (3%)
 Frame = +1

Query: 25  NRITKQLVPNWIVTYCKSEMASTATLIQPSG--ELWKKIREELNEDVNTRAQDLAAIKEW 198
           +R+ K+L         +   A+ A L+  +   ++WKK+     ++     Q     +E+
Sbjct: 52  SRMIKELYQQTEPKSHRPSYANKAVLLSSAKWEQMWKKVVSPAEKETEVLCQQEREFREY 111

Query: 199 LRK-QPHLPDEWEDACLMTFSEAVASPLRNVK 291
           LR     +   WE+       +  A  LR  K
Sbjct: 112 LRNGSKKMTSTWENTVQNIRDKKEAERLRRDK 143


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 871,850
Number of Sequences: 2352
Number of extensions: 18942
Number of successful extensions: 26
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 83576403
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).