SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30041
         (747 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY341156-1|AAR13720.1|   98|Anopheles gambiae BolA protein.            25   2.5  
AY341155-1|AAR13719.1|   98|Anopheles gambiae BolA protein.            25   2.5  
AY341154-1|AAR13718.1|   98|Anopheles gambiae BolA protein.            25   2.5  
AY341153-1|AAR13717.1|   98|Anopheles gambiae BolA protein.            25   2.5  
AY341152-1|AAR13716.1|   98|Anopheles gambiae BolA protein.            25   2.5  
DQ230894-1|ABD94313.1|  315|Anopheles gambiae zinc finger protei...    24   5.7  
DQ230893-1|ABD94311.1|  315|Anopheles gambiae zinc finger protei...    24   5.7  

>AY341156-1|AAR13720.1|   98|Anopheles gambiae BolA protein.
          Length = 98

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +1

Query: 388 YPFSVWKGSKERHFKVLKLSPE 453
           Y  +V KGS E HFKVL +SP+
Sbjct: 21  YMHNVPKGS-ETHFKVLVVSPQ 41


>AY341155-1|AAR13719.1|   98|Anopheles gambiae BolA protein.
          Length = 98

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +1

Query: 388 YPFSVWKGSKERHFKVLKLSPE 453
           Y  +V KGS E HFKVL +SP+
Sbjct: 21  YMHNVPKGS-ETHFKVLVVSPQ 41


>AY341154-1|AAR13718.1|   98|Anopheles gambiae BolA protein.
          Length = 98

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +1

Query: 388 YPFSVWKGSKERHFKVLKLSPE 453
           Y  +V KGS E HFKVL +SP+
Sbjct: 21  YMHNVPKGS-ETHFKVLVVSPQ 41


>AY341153-1|AAR13717.1|   98|Anopheles gambiae BolA protein.
          Length = 98

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +1

Query: 388 YPFSVWKGSKERHFKVLKLSPE 453
           Y  +V KGS E HFKVL +SP+
Sbjct: 21  YMHNVPKGS-ETHFKVLVVSPQ 41


>AY341152-1|AAR13716.1|   98|Anopheles gambiae BolA protein.
          Length = 98

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +1

Query: 388 YPFSVWKGSKERHFKVLKLSPE 453
           Y  +V KGS E HFKVL +SP+
Sbjct: 21  YMHNVPKGS-ETHFKVLVVSPQ 41


>DQ230894-1|ABD94313.1|  315|Anopheles gambiae zinc finger protein
           183 protein.
          Length = 315

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = -1

Query: 315 LMNYTRFFKKXXXXXXXXXXIYKNRLPLMAVSTIQAT 205
           L NYT+FFKK              + P+ A + I++T
Sbjct: 135 LNNYTQFFKKKDSAQGNAASGMVRKGPIRAPANIRST 171


>DQ230893-1|ABD94311.1|  315|Anopheles gambiae zinc finger protein
           183 protein.
          Length = 315

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = -1

Query: 315 LMNYTRFFKKXXXXXXXXXXIYKNRLPLMAVSTIQAT 205
           L NYT+FFKK              + P+ A + I++T
Sbjct: 135 LNNYTQFFKKKDSAQGNAASGMVRKGPIRAPANIRST 171


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 796,628
Number of Sequences: 2352
Number of extensions: 17542
Number of successful extensions: 27
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76923555
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).