SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         186   7e-49
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         186   7e-49
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         186   7e-49
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          177   3e-46
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            25   2.1  
X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.             24   4.9  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   6.5  
AJ276487-1|CAB90819.1|  375|Anopheles gambiae serine protease pr...    23   6.5  
U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.         23   8.5  
U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.         23   8.5  
EF014219-1|ABJ91581.1|  647|Anopheles gambiae cation proton anti...    23   8.5  
AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine...    23   8.5  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  186 bits (452), Expect = 7e-49
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 7e-37
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 8e-23
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  186 bits (452), Expect = 7e-49
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 7e-37
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 8e-23
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  186 bits (452), Expect = 7e-49
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 7e-37
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 8e-23
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  177 bits (431), Expect = 3e-46
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA+YVAIQAVLSLYASGRTTG+
Sbjct: 128 FAAPAVYVAIQAVLSLYASGRTTGV 152



 Score =  137 bits (331), Expect = 3e-34
 Identities = 62/71 (87%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.7 bits (235), Expect = 1e-22
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILR+DLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRMDLAGRDLTDYLMKILTERG 198


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)
 Frame = +1

Query: 235  SKRGILTSN---TPSNTESSLTGMTWRRFGIIPSTM 333
            S+ G+LT+       N + S  G TW++  I P+TM
Sbjct: 1051 SQFGVLTNQHGVVTGNVQLSFDGQTWQQQPIDPATM 1086


>X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.
          Length = 1231

 Score = 23.8 bits (49), Expect = 4.9
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +1

Query: 424  CSKHSTRPPCTSPSKPCSRCTRPV 495
            C+KH TR P   P +    C  P+
Sbjct: 987  CNKHKTRVPHILPYESSRVCLTPI 1010


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 6.5
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 49  FKMCDEEVAALVVDNGSGMC 108
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>AJ276487-1|CAB90819.1|  375|Anopheles gambiae serine protease
           protein.
          Length = 375

 Score = 23.4 bits (48), Expect = 6.5
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 3/52 (5%)
 Frame = +1

Query: 448 PCTSPSKPCSRCTR-PVVPPVCAGLRRRCLPH--RTHLRGIRTPSRHPASGL 594
           PCT+P+    RC R      V   LR+    H    HL G++  +R     L
Sbjct: 29  PCTTPNGTAGRCVRVRECGYVLDLLRKDLFAHSDTVHLEGLQCGTRPDGGAL 80


>U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +3

Query: 489 SGRTTGMCWTPATVSPTPYP 548
           +G + G    PAT  PTP P
Sbjct: 402 NGASNGGSGAPATAKPTPKP 421


>U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +3

Query: 489 SGRTTGMCWTPATVSPTPYP 548
           +G + G    PAT  PTP P
Sbjct: 402 NGASNGGSGAPATAKPTPKP 421


>EF014219-1|ABJ91581.1|  647|Anopheles gambiae cation proton
           antiporter protein.
          Length = 647

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 7/19 (36%), Positives = 13/19 (68%)
 Frame = -1

Query: 424 MIWVIFSLLALGLRGASVR 368
           + W+IF  +  G+ GAS++
Sbjct: 454 IFWMIFEPILFGITGASIK 472


>AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine
           protease protein.
          Length = 405

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = -1

Query: 436 NVSNMIWVIFSLLALGLRGASV 371
           ++   IW I  +++LG+RG  V
Sbjct: 361 DMKRAIWYITGIVSLGVRGCGV 382


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 780,651
Number of Sequences: 2352
Number of extensions: 18269
Number of successful extensions: 72
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 72
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65650335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).