SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X98186-1|CAA66861.1|  269|Anopheles gambiae put. S3a ribosomal p...   151   2e-38
AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.    25   2.3  
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    25   2.3  
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           24   4.0  
AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.           24   4.0  
AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.           24   4.0  
AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.           24   4.0  
AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.           24   4.0  
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           24   4.0  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           24   4.0  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    23   9.2  

>X98186-1|CAA66861.1|  269|Anopheles gambiae put. S3a ribosomal
           protein homologue protein.
          Length = 269

 Score =  151 bits (367), Expect = 2e-38
 Identities = 72/104 (69%), Positives = 84/104 (80%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NFHGM LTTDKLR MV KWQTLIE ++DVKTTDG++LRVFCIGFT KDS+SQRKTCY
Sbjct: 99  VLTNFHGMALTTDKLRSMVNKWQTLIECSVDVKTTDGFMLRVFCIGFTIKDSMSQRKTCY 158

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQH+Q++ IR KM  II R++T++D         PDSIAKDIEK
Sbjct: 159 AQHSQIKNIRAKMTAIIKREITSTDLKGVVEKLLPDSIAKDIEK 202



 Score =  147 bits (357), Expect = 3e-37
 Identities = 69/84 (82%), Positives = 75/84 (89%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPFTRKDWYDVKAP+MF  RQ G TLVNRTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGSKKKVVDPFTRKDWYDVKAPNMFKNRQSGKTLVNRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ + DAERSFRKF+L+AE V GR
Sbjct: 74  LQNEPDAERSFRKFKLVAESVNGR 97



 Score = 27.9 bits (59), Expect = 0.33
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = +3

Query: 585 YPLRDVWHPKVKVLKRAPFSEISKLI 662
           YPL DV+  KVKVLK+  F ++S L+
Sbjct: 208 YPLHDVYIRKVKVLKKPRF-DLSSLM 232


>AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.
          Length = 1201

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 8/25 (32%), Positives = 19/25 (76%)
 Frame = -2

Query: 557 SLAMESGNQLVHHLPESELVTSRVM 483
           ++ + +GN+L HH+ ES+ V ++++
Sbjct: 550 AVEVTAGNRLFHHIVESDRVGTQIL 574


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCHGR 570
           +PN       +GPL H+     N ++   CH R
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMR 60


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 668 VPNQLRDLRKRGPLQHFHFRMPNIAQRVRCH 576
           +PN       +GPL H+     N ++   CH
Sbjct: 28  IPNHPNCPEMQGPLPHYFIHPTNCSRFYECH 58


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%)
 Frame = -1

Query: 696 PCLHRLRRESSQSTSRSPKTGPSSTLSLSDAK-HRAEGKMPWQALLDVLGNGVRKSTCS 523
           PC + + R +   T+   K+  SS+ SLS  +   A      Q+L   +  G   ST S
Sbjct: 107 PCPNLIPRPAEVPTTPEHKSAASSSCSLSTLETQTATAGASVQSLPIAIATGATSSTVS 165


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 779,111
Number of Sequences: 2352
Number of extensions: 16678
Number of successful extensions: 46
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71086350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).