SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF043443-1|AAC05668.1|  232|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043442-1|AAC05667.1|  231|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043441-1|AAC05666.1|  231|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043440-1|AAC05665.1|  234|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043439-1|AAC05664.1|  239|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043438-1|AAC05663.1|  231|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043437-1|AAC05662.1|  239|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043436-1|AAC05661.1|  263|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043435-1|AAC05660.1|  231|Anopheles gambiae pupal-specific cut...    69   8e-14
AF043434-1|AAC05659.1|  232|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043433-3|AAC05658.1|  231|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043433-2|AAC05657.1|  239|Anopheles gambiae putative pupal-spe...    69   8e-14
AF043433-1|AAC05656.1|  231|Anopheles gambiae putative pupal-spe...    68   2e-13
U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles ...    51   2e-08
AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan transpo...    27   0.56 
AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan transpo...    27   0.56 
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    26   0.99 
AJ439060-9|CAD27760.1|  348|Anopheles gambiae putative translati...    25   1.3  
AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.      24   3.0  
Z49815-1|CAA89969.1|  237|Anopheles gambiae serine proteinase pr...    23   5.3  
AJ439060-16|CAD27767.1|  278|Anopheles gambiae hypothetical prot...    23   5.3  
M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           23   6.9  
AY994095-1|AAX86008.1|  144|Anopheles gambiae unknown protein.         23   6.9  
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    23   9.2  

>AF043443-1|AAC05668.1|  232|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 232

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 85  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +3

Query: 171 QSYHVVPVAAHHGAPTIHAAPVLVHH 248
           Q +H  P+A H+ AP  H A  + HH
Sbjct: 185 QHHHAAPIA-HYAAPIAHHAAPIAHH 209



 Score = 27.9 bits (59), Expect = 0.24
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 174 SYHVVPVAAHHGAPTIHAAPVLVH 245
           ++H  P+A HH AP  H+   +VH
Sbjct: 200 AHHAAPIA-HHAAPIAHSTSSIVH 222



 Score = 25.8 bits (54), Expect = 0.99
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = +3

Query: 132 IRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVH 245
           + H     H     +++  P+ AHH AP  H A  + H
Sbjct: 179 VAHATVQHHHAAPIAHYAAPI-AHHAAPIAHHAAPIAH 215



 Score = 24.6 bits (51), Expect = 2.3
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H A  + HH
Sbjct: 184 VQHHHAAPIAHYAAPIAHH 202



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58


>AF043442-1|AAC05667.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2c protein.
          Length = 231

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 177 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 208



 Score = 26.2 bits (55), Expect = 0.75
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVA------AHHGAPTIHAAPVLVH 245
           H     H +   ++H  P+A      AHH AP  H+   +VH
Sbjct: 180 HAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 221



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 176 VQHHHAAPIAHYSAPIAHH 194


>AF043441-1|AAC05666.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 29.1 bits (62), Expect = 0.11
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +3

Query: 132 IRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHH 248
           + H     H     +++  P+A HH AP  H A  + HH
Sbjct: 171 VAHATVQHHHAAPIAHYAAPIA-HHAAPIAHYAAPIAHH 208



 Score = 25.4 bits (53), Expect = 1.3
 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 6/63 (9%)
 Frame = +3

Query: 117 SSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTI---HAAPVL---VHHHETRQYIMET 278
           +S S I+H       + G S H  P    H APTI    A P +   V HH    Y    
Sbjct: 30  TSHSSIQHHAAPAIHHVG-SIHAAPAIYQHSAPTIVKTIAQPTIIKSVEHHAPANYEFSY 88

Query: 279 SLN 287
           S++
Sbjct: 89  SVH 91



 Score = 25.4 bits (53), Expect = 1.3
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +3

Query: 174 SYHVVPVAAHHGAPTIHAAPVLVH 245
           +++  P+A HH AP  H+   +VH
Sbjct: 199 AHYAAPIA-HHAAPIAHSTSSIVH 221


>AF043440-1|AAC05665.1|  234|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 234

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 29.5 bits (63), Expect = 0.080
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +3

Query: 120 SQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVH 245
           S  I  H     H     ++H  P+A HH AP  H+   +VH
Sbjct: 184 SAPIAHHAAPIAHYAAPIAHHAAPIA-HHAAPIAHSTSSIVH 224



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 173 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 204



 Score = 28.3 bits (60), Expect = 0.18
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHH 248
           H     H +   ++H  P+A H+ AP  H A  + HH
Sbjct: 176 HAAPIAHYSAPIAHHAAPIA-HYAAPIAHHAAPIAHH 211



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 172 VQHHHAAPIAHYSAPIAHH 190


>AF043439-1|AAC05664.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 85  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 185 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 216



 Score = 26.2 bits (55), Expect = 0.75
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVA------AHHGAPTIHAAPVLVH 245
           H     H +   ++H  P+A      AHH AP  H+   +VH
Sbjct: 188 HAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 229



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 184 VQHHHAAPIAHYSAPIAHH 202


>AF043438-1|AAC05663.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 29.1 bits (62), Expect = 0.11
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +3

Query: 132 IRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHH 248
           + H     H     +++  P+A HH AP  H A  + HH
Sbjct: 171 VAHATVQHHHAAPIAHYAAPIA-HHAAPIAHYAAPIAHH 208



 Score = 25.4 bits (53), Expect = 1.3
 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 6/30 (20%)
 Frame = +3

Query: 174 SYHVVPVA------AHHGAPTIHAAPVLVH 245
           ++H  P+A      AHH AP  H+   +VH
Sbjct: 192 AHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 221



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58


>AF043437-1|AAC05662.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 85  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 185 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 216



 Score = 26.2 bits (55), Expect = 0.75
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVA------AHHGAPTIHAAPVLVH 245
           H     H +   ++H  P+A      AHH AP  H+   +VH
Sbjct: 188 HAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 229



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 184 VQHHHAAPIAHYSAPIAHH 202


>AF043436-1|AAC05661.1|  263|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2c protein.
          Length = 263

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 109 EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 209 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 240



 Score = 26.2 bits (55), Expect = 0.75
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVA------AHHGAPTIHAAPVLVH 245
           H     H +   ++H  P+A      AHH AP  H+   +VH
Sbjct: 212 HAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 253



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 208 VQHHHAAPIAHYSAPIAHH 226


>AF043435-1|AAC05660.1|  231|Anopheles gambiae pupal-specific
           cuticular protein CP2b protein.
          Length = 231

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 29.1 bits (62), Expect = 0.11
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +3

Query: 132 IRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHH 248
           + H     H     +++  P+A HH AP  H A  + HH
Sbjct: 171 VAHATVQHHHAAPIAHYAAPIA-HHAAPIAHYAAPIAHH 208



 Score = 25.4 bits (53), Expect = 1.3
 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 6/30 (20%)
 Frame = +3

Query: 174 SYHVVPVA------AHHGAPTIHAAPVLVH 245
           ++H  P+A      AHH AP  H+   +VH
Sbjct: 192 AHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 221



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58


>AF043434-1|AAC05659.1|  232|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 232

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 85  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +3

Query: 171 QSYHVVPVAAHHGAPTIHAAPVLVHH 248
           Q +H  P+A H+ AP  H A  + HH
Sbjct: 185 QHHHAAPIA-HYAAPIAHHAAPIAHH 209



 Score = 27.9 bits (59), Expect = 0.24
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 174 SYHVVPVAAHHGAPTIHAAPVLVH 245
           ++H  P+A HH AP  H+   +VH
Sbjct: 200 AHHAAPIA-HHAAPIAHSTSSIVH 222



 Score = 25.8 bits (54), Expect = 0.99
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = +3

Query: 132 IRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVH 245
           + H     H     +++  P+ AHH AP  H A  + H
Sbjct: 179 VAHATVQHHHAAPIAHYAAPI-AHHAAPIAHHAAPIAH 215



 Score = 24.6 bits (51), Expect = 2.3
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H A  + HH
Sbjct: 184 VQHHHAAPIAHYAAPIAHH 202



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58


>AF043433-3|AAC05658.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 177 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 208



 Score = 26.2 bits (55), Expect = 0.75
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVA------AHHGAPTIHAAPVLVH 245
           H     H +   ++H  P+A      AHH AP  H+   +VH
Sbjct: 180 HAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 221



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +3

Query: 177 YHVVPVAAHHGAPTIHAAPVLVHH 248
           +H  P   H G+  +HAAP +  H
Sbjct: 37  HHAAPAIHHVGS--VHAAPAIYQH 58



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 176 VQHHHAAPIAHYSAPIAHH 194


>AF043433-2|AAC05657.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 239

 Score = 69.3 bits (162), Expect = 8e-14
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 85  EHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 185 QHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 216



 Score = 26.2 bits (55), Expect = 0.75
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVA------AHHGAPTIHAAPVLVH 245
           H     H +   ++H  P+A      AHH AP  H+   +VH
Sbjct: 188 HAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVH 229



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 184 VQHHHAAPIAHYSAPIAHH 202


>AF043433-1|AAC05656.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 68.1 bits (159), Expect = 2e-13
 Identities = 29/60 (48%), Positives = 39/60 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++ A   Y F Y + D HTGD+K+QHETR GD V G YSL ++DG  R+V+Y A+    F
Sbjct: 77  EHHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 28.7 bits (61), Expect = 0.14
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%)
 Frame = +3

Query: 171 QSYHVVPVA------AHHGAPTIHAAPVLVHH 248
           Q +H  P+A      AHH AP  H A  + HH
Sbjct: 177 QHHHAAPIAHYSAPIAHHAAPITHYAAPIAHH 208



 Score = 25.4 bits (53), Expect = 1.3
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +3

Query: 174 SYHVVPVAAHHGAPTIHAAPVLVH 245
           +++  P+A HH AP  H+   +VH
Sbjct: 199 THYAAPIA-HHAAPIAHSTSSIVH 221



 Score = 23.4 bits (48), Expect = 5.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +3

Query: 192 VAAHHGAPTIHAAPVLVHH 248
           V  HH AP  H +  + HH
Sbjct: 176 VQHHHAAPIAHYSAPIAHH 194


>U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles
           gambiae putativecuticle protein mRNA, partial cds. ).
          Length = 160

 Score = 51.2 bits (117), Expect = 2e-08
 Identities = 23/42 (54%), Positives = 31/42 (73%)
 Frame = +2

Query: 347 TGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           TGD KSQ E+RDGDVV+G YS+ + DG+ R V+Y+A+    F
Sbjct: 34  TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 75


>AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 26.6 bits (56), Expect = 0.56
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 5/36 (13%)
 Frame = -3

Query: 340 VFD-FVFKCIFGMSIII----FILRLVSMMYWRVSW 248
           VF+ F F  I+G+S I     F+L + + +YWR+ W
Sbjct: 499 VFEMFAFAWIYGVSRICRDIEFMLGIKTGLYWRICW 534


>AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 26.6 bits (56), Expect = 0.56
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 5/36 (13%)
 Frame = -3

Query: 340 VFD-FVFKCIFGMSIII----FILRLVSMMYWRVSW 248
           VF+ F F  I+G+S I     F+L + + +YWR+ W
Sbjct: 499 VFEMFAFAWIYGVSRICRDIEFMLGIKTGLYWRICW 534


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
            methoprene-tolerant protein protein.
          Length = 1115

 Score = 25.8 bits (54), Expect = 0.99
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%)
 Frame = +2

Query: 386  DVVKGYYSLHEADGSI-RVVEYSAEQAQ 466
            D V GY SLHE+   + R+VE   EQ +
Sbjct: 980  DRVSGYSSLHESQNRLDRIVEEHQEQRE 1007


>AJ439060-9|CAD27760.1|  348|Anopheles gambiae putative translation
           initiation factor protein.
          Length = 348

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +3

Query: 162 NEGQSYHVVPVAAHHGAPTIHAAP 233
           N+  +Y +  VA HHG P   AAP
Sbjct: 251 NKIGTYQMAVVAKHHGVPFYVAAP 274


>AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.
          Length = 565

 Score = 24.2 bits (50), Expect = 3.0
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = +1

Query: 172 NPTMLYQ*QRIMELRLYTLHPC 237
           NP   Y  + I+ LRL TL PC
Sbjct: 31  NPLSTYLYRTILALRLVTLLPC 52


>Z49815-1|CAA89969.1|  237|Anopheles gambiae serine proteinase
           protein.
          Length = 237

 Score = 23.4 bits (48), Expect = 5.3
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = -2

Query: 560 AKIKAFLMMVVLLYRLGSFVGAVCLND 480
           A +K +  +V+LLYR   + G   +ND
Sbjct: 7   ADVKEYPWIVMLLYRGAFYCGGSLIND 33


>AJ439060-16|CAD27767.1|  278|Anopheles gambiae hypothetical protein
           protein.
          Length = 278

 Score = 23.4 bits (48), Expect = 5.3
 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 HGHGNEGQSYHVVPVAAHH--GAPTIHAAPVLVHHH 251
           H H +  +    VPV      G P  H  P+ V H+
Sbjct: 154 HLHSSVSEKSKTVPVPVFQKVGVPVPHPVPIAVPHY 189


>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 23.0 bits (47), Expect = 6.9
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = +3

Query: 204  HGAPTIHAAPVLVHHHETRQYI 269
            HG  T H A VL  H   R+Y+
Sbjct: 976  HGEMTFHLAQVLSGHGFFREYL 997


>AY994095-1|AAX86008.1|  144|Anopheles gambiae unknown protein.
          Length = 144

 Score = 23.0 bits (47), Expect = 6.9
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +3

Query: 420 LMDLSVLWNTPPSKHNGFNAVVQAHCSDKAAEPVQQYYH 536
           L+   ++W+T  +      AVV  H SD     V + YH
Sbjct: 70  LVHKQLIWDTASAGQVPLGAVVGGHTSDGEILYVGRAYH 108


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1154

 Score = 22.6 bits (46), Expect = 9.2
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +3

Query: 201 HHGAPTIHAAPVLVHHHETRQYI 269
           +HG  T H + VL  H   R+Y+
Sbjct: 923 NHGEVTFHLSQVLSGHGFLREYL 945


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 595,175
Number of Sequences: 2352
Number of extensions: 12872
Number of successful extensions: 131
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 40
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 103
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 53404389
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).