SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30029
         (530 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY748851-1|AAV28197.1|   98|Anopheles gambiae cytochrome P450 pr...    24   2.8  
AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR ...    23   4.8  
AY263176-1|AAP78791.1|  705|Anopheles gambiae TmcB-like protein ...    23   6.4  
AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.    23   6.4  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    23   8.4  
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    23   8.4  

>AY748851-1|AAV28197.1|   98|Anopheles gambiae cytochrome P450
           protein.
          Length = 98

 Score = 24.2 bits (50), Expect = 2.8
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +1

Query: 319 FYDGIF*FCTLLCMCNYQLAI 381
           F+ GI    TLLC  +Y+LA+
Sbjct: 23  FFGGIETTTTLLCFTSYELAV 43


>AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR
           protein.
          Length = 640

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +1

Query: 268 VRYIRNTFTLVSRF*KNFYDGIF*FCTLLCMCNY 369
           VRYI N+          F+DG   FC L+C+ ++
Sbjct: 390 VRYIENSPKSAFTGRIEFWDGGRDFCFLICLFSF 423


>AY263176-1|AAP78791.1|  705|Anopheles gambiae TmcB-like protein
           protein.
          Length = 705

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +3

Query: 318 FL*RYFLILYTFVHVQLSIGH 380
           FL    L+L TFV V +S+GH
Sbjct: 206 FLTITILLLATFVFVSVSMGH 226


>AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.
          Length = 1376

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = +3

Query: 3   LISAPGGKRSKRSNSIQNRVNFYANESVKKTRTKRTV 113
           L+SA   K S   NS+       AN      R K+T+
Sbjct: 367 LVSAKESKESTLKNSLDKFAKVQANMRATNERRKKTL 403


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +1

Query: 277 IRNTFTLVSRF*KNFYDGIF*FCTL 351
           I+  F+  S+F KN   GI+  C L
Sbjct: 748 IKQLFSAASKFQKNLKRGIYLACVL 772


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
           growth factor receptorprotein.
          Length = 1433

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = +2

Query: 332 FFNSVHFCACATINW 376
           FFN+ + C   +INW
Sbjct: 119 FFNNYNLCHMKSINW 133


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 547,679
Number of Sequences: 2352
Number of extensions: 10329
Number of successful extensions: 21
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 49051644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).