SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    50   6e-08
AB090817-1|BAC57909.1|  344|Anopheles gambiae gag-like protein p...    25   1.9  
AY341174-1|AAR13738.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
AY341173-1|AAR13737.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
AY341172-1|AAR13736.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
AY341171-1|AAR13735.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
AY341170-1|AAR13734.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
AY341169-1|AAR13733.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
AY341168-1|AAR13732.1|  280|Anopheles gambiae fibrinogen protein.      25   3.4  
EF426240-1|ABO26483.1|   64|Anopheles gambiae unknown protein.         24   4.5  
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    24   5.9  
EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.         23   7.8  
EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.         23   7.8  
AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR ...    23   7.8  
AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide recepto...    23   7.8  

>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 50.4 bits (115), Expect = 6e-08
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA F + ++  +       +   R    +I+APTRELA QI             K   
Sbjct: 223 GKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKVCV 282

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
             GGT V+  ++ +  G HV+V TPGR+ D I
Sbjct: 283 SYGGTAVQHQLQLMRGGCHVLVATPGRLLDFI 314



 Score = 33.9 bits (74), Expect = 0.006
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS----ADVQVILLSATMPDDVLEVSRCFMRDP 449
           +   VLDEAD ML  GF   I  V    +       Q ++ SAT P ++ E++  F+ + 
Sbjct: 324 VNFVVLDEADRMLDMGFLPSIEKVMGHATMPEKQQRQTLMFSATFPAEIQELAGKFLHNY 383

Query: 450 VRILV 464
           + + V
Sbjct: 384 ICVFV 388


>AB090817-1|BAC57909.1|  344|Anopheles gambiae gag-like protein
           protein.
          Length = 344

 Score = 25.4 bits (53), Expect = 1.9
 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 2/27 (7%)
 Frame = -1

Query: 324 WTTFH--QLHQEQKV*WCWHEAHDEYH 250
           W+  H  ++ +EQK   CW   H  YH
Sbjct: 263 WSICHIREVMEEQKCYKCWKVGHTSYH 289


>AY341174-1|AAR13738.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>AY341173-1|AAR13737.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>AY341172-1|AAR13736.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>AY341171-1|AAR13735.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>AY341170-1|AAR13734.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>AY341169-1|AAR13733.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>AY341168-1|AAR13732.1|  280|Anopheles gambiae fibrinogen protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = +1

Query: 442 EILYAYLYRRKSLPWKVLNNFTCIELEEWKL---ETLCDLYDTL 564
           ++  + L+    L   V NN T ++ + WK+   +T+C  +D +
Sbjct: 32  KVFGSMLWAISRLDQAVGNNLTALQAQSWKILSRQTICSNHDQM 75


>EF426240-1|ABO26483.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 212 FMWWWALQVVY 244
           FMWWW L+ ++
Sbjct: 24  FMWWWVLRHLF 34


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -1

Query: 627  DSVSQSHLATGVAENYSL 574
            DSVSQ+   +G  +NYSL
Sbjct: 3269 DSVSQTSSTSGYRDNYSL 3286


>EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 212 FMWWWAL 232
           FMWWW L
Sbjct: 24  FMWWWVL 30


>AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR
           protein.
          Length = 640

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 11/30 (36%), Positives = 13/30 (43%)
 Frame = -3

Query: 127 ELSPPSEFVGPALLWEPGSKLDIHECLYRF 38
           E SP S F G    W+ G       CL+ F
Sbjct: 394 ENSPKSAFTGRIEFWDGGRDFCFLICLFSF 423


>AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide receptor
           protein.
          Length = 493

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +3

Query: 612 IGSLNLCICVTLLYLLC 662
           IG   + ICV +++LLC
Sbjct: 307 IGLATMLICVVIVFLLC 323


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 903,703
Number of Sequences: 2352
Number of extensions: 20935
Number of successful extensions: 61
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79418373
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).