SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY745213-1|AAU93480.1|  171|Anopheles gambiae cytochrome P450 pr...    27   0.67 
AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona...    24   4.7  
AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol ...    23   8.2  

>AY745213-1|AAU93480.1|  171|Anopheles gambiae cytochrome P450
           protein.
          Length = 171

 Score = 27.1 bits (57), Expect = 0.67
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 2/60 (3%)
 Frame = +3

Query: 171 EEMADYETALDKAGYGRFSRSALGACVCLSSHQECRTALCLTSCRL--RDVSYS*RHTKQ 344
           EE+ D+   +  AG    +  A  AC+ L+ H E +       C L   DV Y+    KQ
Sbjct: 41  EEITDHIYTMIAAGNETSATQAAHACLLLAMHPEIQDRAAAEICELLADDVEYTHETLKQ 100


>AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate
           anion exchanger protein.
          Length = 1102

 Score = 24.2 bits (50), Expect = 4.7
 Identities = 15/52 (28%), Positives = 22/52 (42%)
 Frame = +2

Query: 116 PENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVRPLQPECFRSVRVPFFASG 271
           P + + HSQR  +      R+ G +   G    RP+ P    + RV F   G
Sbjct: 43  PGSSRRHSQRRRHKHHQASRENGDKGSTGSEAERPVTPP---AQRVQFILGG 91


>AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol
           kinase protein.
          Length = 555

 Score = 23.4 bits (48), Expect = 8.2
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -3

Query: 530 NPLMVLAAAEVCSLERC 480
           NP+ VL A  +C++E C
Sbjct: 53  NPVEVLEAVRLCAVEAC 69


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 919,258
Number of Sequences: 2352
Number of extensions: 20744
Number of successful extensions: 36
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 83576403
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).