SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding pr...    24   3.7  
AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding pr...    24   3.7  
AY578805-1|AAT07310.1|  753|Anopheles gambiae medea protein.           23   8.7  

>AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding
           protein AgamOBP42 protein.
          Length = 288

 Score = 23.8 bits (49), Expect = 3.7
 Identities = 8/31 (25%), Positives = 16/31 (51%)
 Frame = +3

Query: 411 GTSTRISLGNFKLPKHFNDDYFKKNKKCVKR 503
           GT     L  + +P   + DY+ +  +C++R
Sbjct: 83  GTLNEHVLAQYFMPDTSDSDYYNRTYRCIER 113


>AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding
           protein OBPjj83d protein.
          Length = 288

 Score = 23.8 bits (49), Expect = 3.7
 Identities = 8/31 (25%), Positives = 16/31 (51%)
 Frame = +3

Query: 411 GTSTRISLGNFKLPKHFNDDYFKKNKKCVKR 503
           GT     L  + +P   + DY+ +  +C++R
Sbjct: 83  GTLNEHVLAQYFMPDTSDSDYYNRTYRCIER 113


>AY578805-1|AAT07310.1|  753|Anopheles gambiae medea protein.
          Length = 753

 Score = 22.6 bits (46), Expect = 8.7
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           LK  +VC+     +  +RVV  GI  SGL L +GP
Sbjct: 120 LKCDSVCV---NPYHYERVVSPGIDLSGLTLQSGP 151


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 572,461
Number of Sequences: 2352
Number of extensions: 12479
Number of successful extensions: 23
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 50320221
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).