SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY227001-1|AAO32818.2|  301|Anopheles gambiae ADP/ATP translocas...   126   8e-31
L11618-1|AAB04104.1|  301|Anopheles gambiae ADP/ATP carrier prot...   118   2e-28
L11617-1|AAB04105.1|  301|Anopheles gambiae ADP/ATP carrier prot...   118   2e-28
AJ439060-12|CAD27763.1|  450|Anopheles gambiae putative tachykin...    25   3.4  
AF457552-1|AAL68782.1|  311|Anopheles gambiae D7 protein long fo...    25   3.4  

>AY227001-1|AAO32818.2|  301|Anopheles gambiae ADP/ATP translocase
           protein.
          Length = 301

 Score =  126 bits (304), Expect = 8e-31
 Identities = 56/73 (76%), Positives = 63/73 (86%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           IISYPFDTVRRRMMMQSGRAKS+++YKNT+ CW  I K EG+  FFKGAFSNVLRGTGGA
Sbjct: 228 IISYPFDTVRRRMMMQSGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VLV YDE+K +L
Sbjct: 288 LVLVFYDEVKALL 300



 Score = 32.7 bits (71), Expect = 0.013
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G   F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANVIR 82


>L11618-1|AAB04104.1|  301|Anopheles gambiae ADP/ATP carrier protein
           protein.
          Length = 301

 Score =  118 bits (285), Expect = 2e-28
 Identities = 53/73 (72%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           IISYPFDTVRRRMMMQS   KS+++YKNT+ CW  I K EG+  FFKGAFSNVLRGTGGA
Sbjct: 228 IISYPFDTVRRRMMMQSWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VLV YDE+K +L
Sbjct: 288 LVLVFYDEVKALL 300



 Score = 32.7 bits (71), Expect = 0.013
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G   F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANVIR 82


>L11617-1|AAB04105.1|  301|Anopheles gambiae ADP/ATP carrier protein
           protein.
          Length = 301

 Score =  118 bits (285), Expect = 2e-28
 Identities = 53/73 (72%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           IISYPFDTVRRRMMMQS   KS+++YKNT+ CW  I K EG+  FFKGAFSNVLRGTGGA
Sbjct: 228 IISYPFDTVRRRMMMQSWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VLV YDE+K +L
Sbjct: 288 LVLVFYDEVKALL 300



 Score = 32.7 bits (71), Expect = 0.013
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G   F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANVIR 82


>AJ439060-12|CAD27763.1|  450|Anopheles gambiae putative tachykinin
           receptor protein.
          Length = 450

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 9/28 (32%), Positives = 14/28 (50%)
 Frame = +1

Query: 58  AKSDILYKNTIHCWATIAKTEGTSPFFK 141
           A S+ +Y   I+CW  +    G   FF+
Sbjct: 343 AMSNSMYNPIIYCWMNLRFRRGFQQFFR 370


>AF457552-1|AAL68782.1|  311|Anopheles gambiae D7 protein long form
           protein.
          Length = 311

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 6/15 (40%), Positives = 12/15 (80%)
 Frame = +2

Query: 350 NDSIIYCFIKCYIIG 394
           ND++ +C++KC + G
Sbjct: 63  NDAVTHCYVKCTLAG 77


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 738,381
Number of Sequences: 2352
Number of extensions: 13406
Number of successful extensions: 19
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80249979
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).