SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase inhi...    27   0.93 
U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette...    25   2.8  
U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette...    25   2.8  
U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette...    25   2.8  
AY341231-1|AAR13795.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AY341230-1|AAR13794.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AY341229-1|AAR13793.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AY341228-1|AAR13792.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AY341227-1|AAR13791.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AY341226-1|AAR13790.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AY341225-1|AAR13789.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   5.0  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    24   5.0  

>AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase
           inhibitor protein protein.
          Length = 335

 Score = 26.6 bits (56), Expect = 0.93
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = -3

Query: 520 GVEPSRDTRKSLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 383
           GV  S  TR S++N  + +  N+D  +    TR S +IS TE S+T
Sbjct: 261 GVLESELTRPSVINGPYIQVQNLDDLI----TRYSGQISTTEQSVT 302


>U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 25.0 bits (52), Expect = 2.8
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 490 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 383
           S L+WF  RY N  + + + ST V   I+ T +++T
Sbjct: 614 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 647


>U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 25.0 bits (52), Expect = 2.8
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 490 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 383
           S L+WF  RY N  + + + ST V   I+ T +++T
Sbjct: 614 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 647


>U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 673

 Score = 25.0 bits (52), Expect = 2.8
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 490 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 383
           S L+WF  RY N  + + + ST V   I+ T +++T
Sbjct: 592 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 625


>AY341231-1|AAR13795.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341230-1|AAR13794.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341229-1|AAR13793.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341228-1|AAR13792.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341227-1|AAR13791.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341226-1|AAR13790.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341225-1|AAR13789.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = -2

Query: 821 RPPKSFRPKSLRPKSTAQSPRP-IAP 747
           RPP   +P  +RP +    PRP I+P
Sbjct: 256 RPPMMGQPPPIRPPNPMGGPRPQISP 281


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 719,300
Number of Sequences: 2352
Number of extensions: 12557
Number of successful extensions: 28
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 88065063
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).