SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF043437-1|AAC05662.1|  239|Anopheles gambiae putative pupal-spe...    33   0.007
AF043443-1|AAC05668.1|  232|Anopheles gambiae putative pupal-spe...    32   0.016
AF043442-1|AAC05667.1|  231|Anopheles gambiae putative pupal-spe...    32   0.016
AF043438-1|AAC05663.1|  231|Anopheles gambiae putative pupal-spe...    32   0.016
AF043435-1|AAC05660.1|  231|Anopheles gambiae pupal-specific cut...    32   0.016
AF043434-1|AAC05659.1|  232|Anopheles gambiae putative pupal-spe...    32   0.016
AF043433-3|AAC05658.1|  231|Anopheles gambiae putative pupal-spe...    31   0.027
AF043441-1|AAC05666.1|  231|Anopheles gambiae putative pupal-spe...    31   0.047
AF043440-1|AAC05665.1|  234|Anopheles gambiae putative pupal-spe...    29   0.14 
AF043439-1|AAC05664.1|  239|Anopheles gambiae putative pupal-spe...    29   0.14 
AF043436-1|AAC05661.1|  263|Anopheles gambiae putative pupal-spe...    29   0.14 
AF043433-2|AAC05657.1|  239|Anopheles gambiae putative pupal-spe...    29   0.14 
AF043433-1|AAC05656.1|  231|Anopheles gambiae putative pupal-spe...    28   0.33 
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    25   2.4  
U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles ...    25   3.1  
AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript...    24   4.1  
DQ383819-1|ABD38144.1|  377|Anopheles gambiae abdominal-B protein.     24   5.4  
AY324313-1|AAQ89698.1|  160|Anopheles gambiae insulin-like pepti...    23   7.2  
AY324309-1|AAQ89694.1|  160|Anopheles gambiae insulin-like pepti...    23   7.2  

>AF043437-1|AAC05662.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 33.5 bits (73), Expect = 0.007
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  SI  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSSIQHHAAPAIH 44



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 205 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 236



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 92  YEFSYSVHDEHTG 104


>AF043443-1|AAC05668.1|  232|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 232

 Score = 32.3 bits (70), Expect = 0.016
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44



 Score = 25.4 bits (53), Expect = 1.8
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 198 PIAHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 229



 Score = 24.2 bits (50), Expect = 4.1
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ + +A    S + + H
Sbjct: 191 PIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVH 222



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 92  YEFSYSVHDEHTG 104


>AF043442-1|AAC05667.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2c protein.
          Length = 231

 Score = 32.3 bits (70), Expect = 0.016
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 197 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AF043438-1|AAC05663.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 32.3 bits (70), Expect = 0.016
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 197 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AF043435-1|AAC05660.1|  231|Anopheles gambiae pupal-specific
           cuticular protein CP2b protein.
          Length = 231

 Score = 32.3 bits (70), Expect = 0.016
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 197 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AF043434-1|AAC05659.1|  232|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 232

 Score = 32.3 bits (70), Expect = 0.016
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44



 Score = 25.4 bits (53), Expect = 1.8
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 198 PIAHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 229



 Score = 24.2 bits (50), Expect = 4.1
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ + +A    S + + H
Sbjct: 191 PIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVH 222



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 92  YEFSYSVHDEHTG 104


>AF043433-3|AAC05658.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 31.5 bits (68), Expect = 0.027
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +H
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIASSHSTIQHHAAPAIH 44



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 197 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AF043441-1|AAC05666.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 30.7 bits (66), Expect = 0.047
 Identities = 20/46 (43%), Positives = 23/46 (50%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           M  K V+L  LVA   AGLL  PV    + A S  SI  H  P +H
Sbjct: 1   MAFKFVLLATLVAAVSAGLL--PVANHGSIATSHSSIQHHAAPAIH 44



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 197 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AF043440-1|AAC05665.1|  234|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 234

 Score = 29.1 bits (62), Expect = 0.14
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 147
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43



 Score = 25.4 bits (53), Expect = 1.8
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 200 PIAHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 231



 Score = 24.2 bits (50), Expect = 4.1
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ + +A    S + + H
Sbjct: 193 PIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVH 224



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AF043439-1|AAC05664.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 29.1 bits (62), Expect = 0.14
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 147
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 205 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 236



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 92  YEFSYSVHDEHTG 104


>AF043436-1|AAC05661.1|  263|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2c protein.
          Length = 263

 Score = 29.1 bits (62), Expect = 0.14
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 147
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 229 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 260



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 116 YEFSYSVHDEHTG 128


>AF043433-2|AAC05657.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 239

 Score = 29.1 bits (62), Expect = 0.14
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 147
           M  K V+L  LVA + AGLL  PV +  + A S  +I  H  P +
Sbjct: 1   MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 205 PIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 236



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 92  YEFSYSVHDEHTG 104


>AF043433-1|AAC05656.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 27.9 bits (59), Expect = 0.33
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 147
           M  K V+   LVA + AGLL  PV +  + A S  +I  H +P +
Sbjct: 1   MAFKFVLFTTLVAAASAGLL--PVAHHGSIATSHSTIQHHARPAI 43



 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 237 PCSVPGAPVAYHTSPLRYSSAESVSSQNIVRH 332
           P +   AP+A+H +P+ +S++  V   + + H
Sbjct: 197 PITHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228



 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 515 YEYNYSVADGHSG 553
           YE++YSV D H+G
Sbjct: 84  YEFSYSVHDEHTG 96


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 10/32 (31%), Positives = 19/32 (59%)
 Frame = -2

Query: 694  TNRV*SPLWFVQPVYFNSSDRARQLRGKSMNP 599
            ++++ +P W+V+ +YF    +  QLR   M P
Sbjct: 2082 SHQILNPNWYVRDLYFFKRSQYPQLRLVEMKP 2113


>U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles
           gambiae putativecuticle protein mRNA, partial cds. ).
          Length = 160

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 586 GDVVKGSYSFHEADG 630
           GDVV+GSYS  + DG
Sbjct: 46  GDVVQGSYSVVDPDG 60


>AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1201

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%)
 Frame = +2

Query: 17  SPKS*YCVL--WSRCRKLDFWLLPCTTLPLKPFLPKALCA 130
           SP   Y V   WS C+KL F    C      P  P  LC+
Sbjct: 20  SPTGVYSVRRRWSLCQKLHFRDQVCCVQRSPPHWPYLLCS 59


>DQ383819-1|ABD38144.1|  377|Anopheles gambiae abdominal-B protein.
          Length = 377

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHT-SPLRYS 293
           P      PG  S  P GP  +P    A+ T + LR+S
Sbjct: 111 PSAASESPGSVSSQPSGPIHIPAKRPAFDTDTRLRHS 147


>AY324313-1|AAQ89698.1|  160|Anopheles gambiae insulin-like peptide
           6 precursor protein.
          Length = 160

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = +1

Query: 25  IVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           + +L ALV +    +++A   Y  AE V   S +  + P LH
Sbjct: 12  LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53


>AY324309-1|AAQ89694.1|  160|Anopheles gambiae insulin-like peptide
           3 precursor protein.
          Length = 160

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = +1

Query: 25  IVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           + +L ALV +    +++A   Y  AE V   S +  + P LH
Sbjct: 12  LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 631,143
Number of Sequences: 2352
Number of extensions: 11755
Number of successful extensions: 101
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).