SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ137801-1|AAZ78362.1|  622|Anopheles gambiae male-specific doub...    29   0.17 
AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcript...    27   0.69 
AF008575-1|AAB87764.1|  525|Anopheles gambiae chitinase protein.       23   6.5  
CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein ...    23   8.5  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          23   8.5  
AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase p...    23   8.5  

>DQ137801-1|AAZ78362.1|  622|Anopheles gambiae male-specific
           doublesex protein protein.
          Length = 622

 Score = 28.7 bits (61), Expect = 0.17
 Identities = 17/65 (26%), Positives = 29/65 (44%)
 Frame = -2

Query: 515 FSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQVLDRRHVEQQALQHVDGYQ 336
           F  H L S   P V   +    +F ++F+G    M + + +   R+  +QQ LQ      
Sbjct: 521 FPTHLLPSSLYPPVSSESTTAPIFHTHFLGYQPQMQLPHVEPFYRKEQQQQQLQQTLAEP 580

Query: 335 REEGT 321
           +E+ T
Sbjct: 581 KEQTT 585


>AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcriptase
           protein.
          Length = 988

 Score = 26.6 bits (56), Expect = 0.69
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = +1

Query: 442 GNTVMLFVSLKTRGRARLLRECHEKKLKRITKDAGEKVSKATNTIS 579
           GN+++ +  + T GR  L +E H K ++R  +    +V+ A  T+S
Sbjct: 779 GNSIIRY-GVATWGRWVLDKETHRKSVQRAHRPGALRVASAFQTVS 823


>AF008575-1|AAB87764.1|  525|Anopheles gambiae chitinase protein.
          Length = 525

 Score = 23.4 bits (48), Expect = 6.5
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -2

Query: 71  DDCRQTAQQMTTAIDHYGLIAKA 3
           D+  Q  ++M    DHYGL+  A
Sbjct: 171 DNHAQLVEEMREEFDHYGLLLTA 193


>CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein
           protein.
          Length = 196

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -2

Query: 155 FVPKEVARNIDLFAANHNN 99
           F+PK+ A N  L+  +H N
Sbjct: 65  FIPKQCAENEILYPGDHEN 83


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +2

Query: 548  RKCRRRQTPFHYHHPNSYGYNLGT 619
            +K R R+      H NS+ YN G+
Sbjct: 1001 QKLRARREQQRREHSNSFSYNYGS 1024


>AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = +2

Query: 533 PRMLVRKCRRRQTPFHYHHPNSYGYNL 613
           P  +VRK RR +  +H H      YN+
Sbjct: 221 PDRVVRKDRRGELFYHMHQQTIARYNI 247


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 724,679
Number of Sequences: 2352
Number of extensions: 15543
Number of successful extensions: 25
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65650335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).