SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ...    26   1.1  
AF283275-1|AAG15376.1|  133|Anopheles gambiae small heat shock p...    26   1.1  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    25   2.5  
DQ518576-1|ABF66618.1|  276|Anopheles gambiae putative cytoplasm...    23   7.8  
AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450 pr...    23   7.8  

>M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles
            gambiae RT2 retroposon. ).
          Length = 1222

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +2

Query: 215  NVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQG 370
            N  A      +E R+ LP T   SPR       +R+R    R  R+   + G
Sbjct: 1114 NRRAATARRREERRAGLPPTPPASPRTAQRRAALRERQARFRERRRNRRLLG 1165


>AF283275-1|AAG15376.1|  133|Anopheles gambiae small heat shock
           protein protein.
          Length = 133

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 11/48 (22%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +2

Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRS-PLPTTKVVSPRKR 298
           P+G  + ++   + ++GIL ++   K   ++N    +P T    P K+
Sbjct: 65  PKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQ 112


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
            protein.
          Length = 1645

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 28/140 (20%), Positives = 60/140 (42%), Gaps = 10/140 (7%)
 Frame = +2

Query: 176  IEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQK 355
            ++ T  I  NG+L    + K   +EN + L      +P+   ++  ++  S+E   ++  
Sbjct: 706  LDSTGTIKRNGVLIQKEVLKILRQENNNRLDVADGNAPKVAGTLGAVQPSSSEAVSSKLP 765

Query: 356  ETIQGQ-------ECIGILLASA*SATMEDEKLKEKILL---NSDKQTIPRTSATSTHSS 505
             T + +       EC+          T+   ++    ++   NSD +  P  SAT+  ++
Sbjct: 766  PTAEPEHSESSDVECVERTERLKVKTTINTSRIPSMCIITPTNSDDEQPPAGSATAKAAT 825

Query: 506  GWDFQSRLAEQGGV*AQGRK 565
              D +S   ++ G+ A  R+
Sbjct: 826  QRDNKS--TDKAGIGAGKRR 843


>DQ518576-1|ABF66618.1|  276|Anopheles gambiae putative cytoplasmic
           carbonic anhydrase protein.
          Length = 276

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -3

Query: 564 FLPCAHTPPCSASLDW 517
           +L    TPPCS S+ W
Sbjct: 196 YLGSLTTPPCSESVTW 211


>AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450
           protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = +2

Query: 329 TETRMTRQKETIQGQECIGILLASA*SATMEDE 427
           TET   R++ +I+  + + +L+      T+EDE
Sbjct: 255 TETVADRERNSIERPDFLNLLIQLKNKGTVEDE 287


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 676,892
Number of Sequences: 2352
Number of extensions: 15102
Number of successful extensions: 44
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 44
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 59711994
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).