SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF457553-1|AAL68783.1|  178|Anopheles gambiae mucin-like protein...    26   1.3  
U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette...    25   2.3  
U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette...    25   2.3  
U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette...    25   2.3  
AY341231-1|AAR13795.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  
AY341230-1|AAR13794.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  
AY341229-1|AAR13793.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  
AY341228-1|AAR13792.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  
AY341227-1|AAR13791.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  
AY341226-1|AAR13790.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  
AY341225-1|AAR13789.1|  231|Anopheles gambiae vacuolar ATPase pr...    24   4.1  

>AF457553-1|AAL68783.1|  178|Anopheles gambiae mucin-like protein
           protein.
          Length = 178

 Score = 25.8 bits (54), Expect = 1.3
 Identities = 13/59 (22%), Positives = 28/59 (47%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTT 255
           ++  +T  + T ++ TSEA T AAA     +++++    + A     ++  +     TT
Sbjct: 67  TSAATTTAATTSAATTSEATTTAAASTTQASDSDNTTTTAEATTTTEAQTTSSSDNSTT 125



 Score = 25.8 bits (54), Expect = 1.3
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = -3

Query: 407 SATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT 276
           +  E++ T+EAQT +++  +++T TE+    +AA    A   +T
Sbjct: 104 TTAEATTTTEAQTTSSS--DNSTTTEAAATTTAASETTADSSST 145


>U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 491 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 384
           S L+WF  RY N  + + + ST V   I+ T +++T
Sbjct: 614 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 647


>U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 491 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 384
           S L+WF  RY N  + + + ST V   I+ T +++T
Sbjct: 614 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 647


>U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 673

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 491 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 384
           S L+WF  RY N  + + + ST V   I+ T +++T
Sbjct: 592 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 625


>AY341231-1|AAR13795.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341230-1|AAR13794.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341229-1|AAR13793.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341228-1|AAR13792.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341227-1|AAR13791.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341226-1|AAR13790.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


>AY341225-1|AAR13789.1|  231|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 231

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -3

Query: 350 ESTTETESIRRVSAAKGNAASRKAT*GSRMTTIATV 243
           + ++  E++R VSAA+     R+   G   T +AT+
Sbjct: 135 DMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATI 170


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 576,516
Number of Sequences: 2352
Number of extensions: 9477
Number of successful extensions: 22
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71922660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).