SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    26   0.56 
AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.    25   0.99 
AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.    24   3.0  
AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced ...    23   6.9  
AY578812-1|AAT07317.1|  932|Anopheles gambiae wishful thinking p...    22   9.2  

>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 1049

 Score = 26.2 bits (55), Expect = 0.56
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +1

Query: 52  QCWPTSSGPSAPGTGILLAVTIIYQYFEI 138
           +C  + SG S+ G G+LLAV+  Y+  E+
Sbjct: 134 RCDRSLSGSSSRGGGVLLAVSNAYESIEL 162


>AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.
          Length = 1201

 Score = 25.4 bits (53), Expect = 0.99
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = -1

Query: 201 SLRDLEEQCAHAAHLRLFLDKDLEVLVNDGDGEQYPS--ARSRWPRGSRPALTE 46
           ++R  EE+C+    L L   K  E+    G G Q+ S   R +W +G   +L +
Sbjct: 353 AMRRKEEECSR--ELNLKEQKRKELYAKQGRGSQFSSKEERDKWIQGELKSLNK 404


>AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.
          Length = 1187

 Score = 23.8 bits (49), Expect = 3.0
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = -3

Query: 280 KRTPNDVDSSRNDNKNGAER 221
           K+  N++   RN+NK+G +R
Sbjct: 909 KKKENEITKVRNENKDGYDR 928


>AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced
           homeotic protein protein.
          Length = 372

 Score = 22.6 bits (46), Expect = 6.9
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +3

Query: 42  GALSVLADFLGAIGSGHWDT 101
           GA SV +   GA+G GH  T
Sbjct: 77  GATSVNSASTGAVGGGHQST 96


>AY578812-1|AAT07317.1|  932|Anopheles gambiae wishful thinking
           protein.
          Length = 932

 Score = 22.2 bits (45), Expect = 9.2
 Identities = 15/39 (38%), Positives = 16/39 (41%)
 Frame = -1

Query: 117 DGDGEQYPSARSRWPRGSRPALTEPRCTVLRTRPPSGCS 1
           D D E   +A     R    A   PR    RT PP GCS
Sbjct: 528 DHDAEARLTAMCVQERLQEVAQINPRA---RTMPPKGCS 563


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 495,266
Number of Sequences: 2352
Number of extensions: 9459
Number of successful extensions: 22
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 40395045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).