SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF043443-1|AAC05668.1|  232|Anopheles gambiae putative pupal-spe...    52   2e-08
AF043439-1|AAC05664.1|  239|Anopheles gambiae putative pupal-spe...    52   2e-08
AF043434-1|AAC05659.1|  232|Anopheles gambiae putative pupal-spe...    52   2e-08
AF043433-2|AAC05657.1|  239|Anopheles gambiae putative pupal-spe...    52   2e-08
AF043442-1|AAC05667.1|  231|Anopheles gambiae putative pupal-spe...    52   3e-08
AF043438-1|AAC05663.1|  231|Anopheles gambiae putative pupal-spe...    52   3e-08
AF043436-1|AAC05661.1|  263|Anopheles gambiae putative pupal-spe...    52   3e-08
AF043435-1|AAC05660.1|  231|Anopheles gambiae pupal-specific cut...    52   3e-08
AF043433-3|AAC05658.1|  231|Anopheles gambiae putative pupal-spe...    52   3e-08
AF043437-1|AAC05662.1|  239|Anopheles gambiae putative pupal-spe...    50   6e-08
AF043433-1|AAC05656.1|  231|Anopheles gambiae putative pupal-spe...    50   6e-08
AF043441-1|AAC05666.1|  231|Anopheles gambiae putative pupal-spe...    50   1e-07
AF043440-1|AAC05665.1|  234|Anopheles gambiae putative pupal-spe...    49   2e-07
U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles ...    42   2e-05
EF382662-1|ABN54495.1|  178|Anopheles gambiae CPF family cuticle...    36   0.001
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    25   2.0  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            24   4.7  
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.            24   6.2  
AY341195-1|AAR13759.1|  294|Anopheles gambiae laminin protein.         23   8.2  
AY341194-1|AAR13758.1|  294|Anopheles gambiae laminin protein.         23   8.2  
AY341193-1|AAR13757.1|  294|Anopheles gambiae laminin protein.         23   8.2  
AY341192-1|AAR13756.1|  294|Anopheles gambiae laminin protein.         23   8.2  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    23   8.2  

>AF043443-1|AAC05668.1|  232|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 232

 Score = 52.0 bits (119), Expect = 2e-08
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 255 AVSSQTILRHDQP---HATNYIAAAAPVHYASPV---HYAAPVAKVIAPAHKVLVSAHHE 416
           A S  TI  H  P   H  +  AA A   +++P    H A  + K IA    +    HH 
Sbjct: 29  ATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHH- 87

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
              A   Y+F+YSV D H+GD KSQHE+R G
Sbjct: 88  ---APANYEFSYSVHDEHTGDIKSQHETRHG 115



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 116 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 34.3 bits (75), Expect = 0.004
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AHH    AH
Sbjct: 167 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYAAPIAHHAAPIAHHAAPIAH 215



 Score = 31.9 bits (69), Expect = 0.023
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +3

Query: 330 HYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           H+A+P+ HYAAP+A   AP AH     AH      H
Sbjct: 187 HHAAPIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVH 222



 Score = 28.3 bits (60), Expect = 0.29
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 7/59 (11%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPV-HYASPV-HYAAPVAK-----VIAPAHKVLVSAHH 413
           V+  T+  H   HA      AAP+ H+A+P+ H+AAP+A      V  P+H   +S HH
Sbjct: 179 VAHATVQHH---HAAPIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVHGPSH---LSHHH 231



 Score = 27.9 bits (59), Expect = 0.38
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +3

Query: 318 AAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVA 461
           A PVH +S  H  APVA      H     AH+    AH     A+  A
Sbjct: 166 AQPVHVSSYAH--APVAHATVQHHHAAPIAHYAAPIAHHAAPIAHHAA 211



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 156 KIAQPVHKVIAQPVHVSSYAH 176


>AF043439-1|AAC05664.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 52.0 bits (119), Expect = 2e-08
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 255 AVSSQTILRHDQP---HATNYIAAAAPVHYASPV---HYAAPVAKVIAPAHKVLVSAHHE 416
           A S  TI  H  P   H  +  AA A   +++P    H A  + K IA    +    HH 
Sbjct: 29  ATSHSTIQHHAAPTIQHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHH- 87

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
              A   Y+F+YSV D H+GD KSQHE+R G
Sbjct: 88  ---APANYEFSYSVHDEHTGDIKSQHETRHG 115



 Score = 39.9 bits (89), Expect = 9e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 116 DEVHGQYSLLDSDGHHRIVDYHADHHTGF 144



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 179 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 236

Query: 432 PKY 440
             Y
Sbjct: 237 HHY 239



 Score = 34.7 bits (76), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 167 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 224

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 225 SSIVHGPSHLSH 236



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 156 KIAQPVHKVIAQPVHVSSYAH 176


>AF043434-1|AAC05659.1|  232|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 232

 Score = 52.0 bits (119), Expect = 2e-08
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 255 AVSSQTILRHDQP---HATNYIAAAAPVHYASPV---HYAAPVAKVIAPAHKVLVSAHHE 416
           A S  TI  H  P   H  +  AA A   +++P    H A  + K IA    +    HH 
Sbjct: 29  ATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHH- 87

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
              A   Y+F+YSV D H+GD KSQHE+R G
Sbjct: 88  ---APANYEFSYSVHDEHTGDIKSQHETRHG 115



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 116 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 34.3 bits (75), Expect = 0.004
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AHH    AH
Sbjct: 167 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYAAPIAHHAAPIAHHAAPIAH 215



 Score = 31.9 bits (69), Expect = 0.023
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +3

Query: 330 HYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           H+A+P+ HYAAP+A   AP AH     AH      H
Sbjct: 187 HHAAPIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVH 222



 Score = 28.3 bits (60), Expect = 0.29
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 7/59 (11%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPV-HYASPV-HYAAPVAK-----VIAPAHKVLVSAHH 413
           V+  T+  H   HA      AAP+ H+A+P+ H+AAP+A      V  P+H   +S HH
Sbjct: 179 VAHATVQHH---HAAPIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVHGPSH---LSHHH 231



 Score = 27.9 bits (59), Expect = 0.38
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +3

Query: 318 AAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVA 461
           A PVH +S  H  APVA      H     AH+    AH     A+  A
Sbjct: 166 AQPVHVSSYAH--APVAHATVQHHHAAPIAHYAAPIAHHAAPIAHHAA 211



 Score = 25.0 bits (52), Expect = 2.7
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 156 KIAHPVHKVIAQPVHVSSYAH 176


>AF043433-2|AAC05657.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 239

 Score = 52.0 bits (119), Expect = 2e-08
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 255 AVSSQTILRHDQP---HATNYIAAAAPVHYASPV---HYAAPVAKVIAPAHKVLVSAHHE 416
           A S  TI  H  P   H  +  AA A   +++P    H A  + K IA    +    HH 
Sbjct: 29  ATSHSTIQHHAAPTIQHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHH- 87

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
              A   Y+F+YSV D H+GD KSQHE+R G
Sbjct: 88  ---APANYEFSYSVHDEHTGDIKSQHETRHG 115



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 116 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 179 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 236

Query: 432 PKY 440
             Y
Sbjct: 237 HHY 239



 Score = 33.1 bits (72), Expect = 0.010
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 1/70 (1%)
 Frame = +3

Query: 288 QPHATNYIAAAAPVHYASPVHYAAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSVAD 464
           QP   +  A A   H     H+AAP+A   AP AH     AH+    AH     A+S + 
Sbjct: 167 QPVDVSSYAHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSS 226

Query: 465 GHSGDNKSQH 494
              G +   H
Sbjct: 227 IVHGPSHLSH 236


>AF043442-1|AAC05667.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2c protein.
          Length = 231

 Score = 51.6 bits (118), Expect = 3e-08
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA----HHEEEYAHPKYDFAYSVA 461
           H+T    AA  +H+   VH A  + +  APA    ++        E +A   Y+F+YSV 
Sbjct: 32  HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVH 91

Query: 462 DGHSGDNKSQHESRDG 509
           D H+GD KSQHE+R G
Sbjct: 92  DEHTGDIKSQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 171 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228

Query: 432 PKY 440
             Y
Sbjct: 229 HHY 231



 Score = 34.3 bits (75), Expect = 0.004
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSVADG 467
           H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S +  
Sbjct: 162 HVSSY--AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSI 219

Query: 468 HSGDNKSQH 494
             G +   H
Sbjct: 220 VHGPSHLSH 228



 Score = 25.0 bits (52), Expect = 2.7
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 148 KIAQPVHKVIAQNVHVSSYAH 168


>AF043438-1|AAC05663.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 51.6 bits (118), Expect = 3e-08
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA----HHEEEYAHPKYDFAYSVA 461
           H+T    AA  +H+   VH A  + +  APA    ++        E +A   Y+F+YSV 
Sbjct: 32  HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVH 91

Query: 462 DGHSGDNKSQHESRDG 509
           D H+GD KSQHE+R G
Sbjct: 92  DEHTGDIKSQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 37.1 bits (82), Expect = 6e-04
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPV-HYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYA 428
           V+  T+  H   HA      AAP+ H+A+P+ HYAAP+A   AP AH      H     +
Sbjct: 171 VAHATVQHH---HAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLS 227

Query: 429 HPKY 440
           H  Y
Sbjct: 228 HHHY 231



 Score = 35.1 bits (77), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 159 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHST 216

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 217 SSIVHGPSHLSH 228



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168


>AF043436-1|AAC05661.1|  263|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2c protein.
          Length = 263

 Score = 51.6 bits (118), Expect = 3e-08
 Identities = 32/85 (37%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 SSQTILRHDQPHATNYIAAAAPVHYASPV--HYAAPVAKVIAPAHKVLVSAHHEEEYAHP 434
           S+  I +H  P    + A A   H A  +  H A  + K IA    +    HH    A  
Sbjct: 59  SAPAIYQHSAPAIYQHSAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHH----APA 114

Query: 435 KYDFAYSVADGHSGDNKSQHESRDG 509
            Y+F+YSV D H+GD KSQHE+R G
Sbjct: 115 NYEFSYSVHDEHTGDIKSQHETRHG 139



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 140 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 168



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 203 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 260

Query: 432 PKY 440
             Y
Sbjct: 261 HHY 263



 Score = 34.7 bits (76), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 191 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 248

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 249 SSIVHGPSHLSH 260



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 180 KIAQPVHKVIAQPVHVSSYAH 200


>AF043435-1|AAC05660.1|  231|Anopheles gambiae pupal-specific
           cuticular protein CP2b protein.
          Length = 231

 Score = 51.6 bits (118), Expect = 3e-08
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA----HHEEEYAHPKYDFAYSVA 461
           H+T    AA  +H+   VH A  + +  APA    ++        E +A   Y+F+YSV 
Sbjct: 32  HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVH 91

Query: 462 DGHSGDNKSQHESRDG 509
           D H+GD KSQHE+R G
Sbjct: 92  DEHTGDIKSQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 37.1 bits (82), Expect = 6e-04
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPV-HYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYA 428
           V+  T+  H   HA      AAP+ H+A+P+ HYAAP+A   AP AH      H     +
Sbjct: 171 VAHATVQHH---HAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLS 227

Query: 429 HPKY 440
           H  Y
Sbjct: 228 HHHY 231



 Score = 35.1 bits (77), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 159 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHST 216

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 217 SSIVHGPSHLSH 228



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168


>AF043433-3|AAC05658.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 51.6 bits (118), Expect = 3e-08
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA----HHEEEYAHPKYDFAYSVA 461
           H+T    AA  +H+   VH A  + +  APA    ++        E +A   Y+F+YSV 
Sbjct: 32  HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVH 91

Query: 462 DGHSGDNKSQHESRDG 509
           D H+GD KSQHE+R G
Sbjct: 92  DEHTGDIKSQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 171 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228

Query: 432 PKY 440
             Y
Sbjct: 229 HHY 231



 Score = 34.7 bits (76), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 159 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 216

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 217 SSIVHGPSHLSH 228



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168


>AF043437-1|AAC05662.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 50.4 bits (115), Expect = 6e-08
 Identities = 34/91 (37%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 255 AVSSQTILRHDQP---HATNYIAAAAPVHYASPV---HYAAPVAKVIAPAHKVLVSAHHE 416
           A S  +I  H  P   H  +  AA A   +++P    H A  + K IA    +    HH 
Sbjct: 29  ATSHSSIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKSVEHH- 87

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
              A   Y+F+YSV D H+GD KSQHE+R G
Sbjct: 88  ---APANYEFSYSVHDEHTGDIKSQHETRHG 115



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 116 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 144



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 179 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 236

Query: 432 PKY 440
             Y
Sbjct: 237 HHY 239



 Score = 34.7 bits (76), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 167 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 224

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 225 SSIVHGPSHLSH 236



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 156 KIAQPVHKVIAQPVHVSSYAH 176


>AF043433-1|AAC05656.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 50.4 bits (115), Expect = 6e-08
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAA--AAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYA 428
           A S  TI  H +P A  ++ +  AAP  Y    H A  + K IA    +    HH    A
Sbjct: 29  ATSHSTIQHHARP-AIQHVGSIHAAPAIYQ---HSAPAIVKTIAQPTIIKSVEHH----A 80

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDG 509
              Y+F+YSV D H+GD K+QHE+R G
Sbjct: 81  PANYEFSYSVHDEHTGDIKNQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH      H     +H
Sbjct: 171 VAHATVQHHHAAPIAHYSAPIA--HHAAPITHYAAPIAHHAAPIAHSTSSIVHGPSHLSH 228

Query: 432 PKY 440
             Y
Sbjct: 229 HHY 231



 Score = 33.1 bits (72), Expect = 0.010
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH      H+    AH     A+S 
Sbjct: 159 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPITHYAAPIAHHAAPIAHST 216

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 217 SSIVHGPSHLSH 228



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168


>AF043441-1|AAC05666.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 49.6 bits (113), Expect = 1e-07
 Identities = 30/76 (39%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
 Frame = +3

Query: 288 QPHATNYIAAAAPVHYASPV--HYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVA 461
           Q HA   I     +H A  +  H A  + K IA    +    HH    A   Y+F+YSV 
Sbjct: 36  QHHAAPAIHHVGSIHAAPAIYQHSAPTIVKTIAQPTIIKSVEHH----APANYEFSYSVH 91

Query: 462 DGHSGDNKSQHESRDG 509
           D H+GD KSQHE+R G
Sbjct: 92  DEHTGDIKSQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 37.1 bits (82), Expect = 6e-04
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPV-HYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYA 428
           V+  T+  H   HA      AAP+ H+A+P+ HYAAP+A   AP AH      H     +
Sbjct: 171 VAHATVQHH---HAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHSTSSIVHGPSHLS 227

Query: 429 HPKY 440
           H  Y
Sbjct: 228 HHHY 231



 Score = 35.1 bits (77), Expect = 0.003
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 288 QP-HATNYIAAAAPVHYASPVHY-AAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSV 458
           QP H ++Y  A APV +A+  H+ AAP+A   AP AH     AH+    AH     A+S 
Sbjct: 159 QPVHVSSY--AHAPVAHATVQHHHAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHST 216

Query: 459 ADGHSGDNKSQH 494
           +    G +   H
Sbjct: 217 SSIVHGPSHLSH 228



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAH 431
           K+  P HKV+    H   YAH
Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168


>AF043440-1|AAC05665.1|  234|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2d protein.
          Length = 234

 Score = 48.8 bits (111), Expect = 2e-07
 Identities = 34/87 (39%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAA--AAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYA 428
           A S  TI  H  P A  ++ +  A P  Y    H A  + K IA    +    HH    A
Sbjct: 29  ATSHSTIQHHAAP-AIQHVGSVHALPAIYQ---HSAPAIVKTIAQPTIIKSVEHH----A 80

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDG 509
              Y+F+YSV D H+GD KSQHE+R G
Sbjct: 81  PANYEFSYSVHDEHTGDIKSQHETRHG 107



 Score = 40.3 bits (90), Expect = 7e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGF 136



 Score = 37.9 bits (84), Expect = 4e-04
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = +3

Query: 330 HYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQH 494
           H+A+P+ HY+AP+A   AP AH     AHH    AH     A+S +    G +   H
Sbjct: 175 HHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 231



 Score = 35.9 bits (79), Expect = 0.001
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPV-HYAAPVAKVIAP-AHKVLVSAHHEEEYAH 431
           V+  T+  H      +Y A  A  H+A+P+ HYAAP+A   AP AH     AH      H
Sbjct: 167 VAHATVQHHHAAPIAHYSAPIA--HHAAPIAHYAAPIAHHAAPIAHHAAPIAHSTSSIVH 224



 Score = 32.3 bits (70), Expect = 0.018
 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 2/53 (3%)
 Frame = +3

Query: 309 IAAAAPVH--YASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVA 461
           +  A PVH   A PVH  APVA      H     AH+    AH     A+  A
Sbjct: 147 VKIAQPVHKVIAQPVHVHAPVAHATVQHHHAAPIAHYSAPIAHHAAPIAHYAA 199


>U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles
           gambiae putativecuticle protein mRNA, partial cds. ).
          Length = 160

 Score = 41.9 bits (94), Expect = 2e-05
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V G Y++V+ DG+ R V+YTAD H+GF       R     + ++  APV
Sbjct: 47  DVVQGSYSVVDPDGTKRTVDYTADPHNGFNAV--VRREPLAAKTIVAAAPV 95



 Score = 29.1 bits (62), Expect = 0.17
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 4/45 (8%)
 Frame = +3

Query: 288 QPHATNYIAAAAPVH---YASP-VHYAAPVAKVIAPAHKVLVSAH 410
           +P A   I AAAPV     A P V YAAPVAK I+ A  V    +
Sbjct: 82  EPLAAKTIVAAAPVATKVIAQPAVAYAAPVAKTISYAAPVATKTY 126



 Score = 26.6 bits (56), Expect = 0.88
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +3

Query: 471 SGDNKSQHESRDGTLCTAS 527
           +GD+KSQ ESRDG +   S
Sbjct: 34  TGDSKSQQESRDGDVVQGS 52


>EF382662-1|ABN54495.1|  178|Anopheles gambiae CPF family cuticle
           protein protein.
          Length = 178

 Score = 36.3 bits (80), Expect = 0.001
 Identities = 27/65 (41%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHP---KYDFAYSVA 461
           P A +Y A A  VHY +  HYAAP   V   AH  +V A +   YA P   K   A  VA
Sbjct: 104 PAAAHYAAPA--VHYPAAAHYAAPA--VHYAAHAPIVKAAYPAAYAAPLAYKTPLAAPVA 159

Query: 462 DGHSG 476
             H G
Sbjct: 160 AVHGG 164



 Score = 32.7 bits (71), Expect = 0.013
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHH 413
           +A +Y A A  VHY +  HYAAP     A AH    + H+
Sbjct: 92  YAAHYAAPA--VHYPAAAHYAAPAVHYPAAAHYAAPAVHY 129



 Score = 31.1 bits (67), Expect = 0.041
 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +3

Query: 297 ATNYIAAAAPVHYASP-VHYAAPVAKVIAPAHKVLVSAHHEEEYAH 431
           A  Y A A   HYA+P VHY A  A   APA     +AH+     H
Sbjct: 84  AVKYAAPAYAAHYAAPAVHYPA-AAHYAAPAVHYPAAAHYAAPAVH 128



 Score = 29.1 bits (62), Expect = 0.17
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAH 389
           H   HA   + AA P  YA+P+ Y  P+A  +A  H
Sbjct: 128 HYAAHAP-IVKAAYPAAYAAPLAYKTPLAAPVAAVH 162



 Score = 23.8 bits (49), Expect = 6.2
 Identities = 13/29 (44%), Positives = 15/29 (51%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPVHYAAPVA 368
           H    A +Y A A  V  A P  YAAP+A
Sbjct: 121 HYAAPAVHYAAHAPIVKAAYPAAYAAPLA 149


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 25.4 bits (53), Expect = 2.0
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPA 386
           P +T++ AAA   H+    H+AA VA   A A
Sbjct: 861 PPSTHHQAAAVAAHHHHLQHHAAMVAAAAAAA 892


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 24.2 bits (50), Expect = 4.7
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = +2

Query: 542  ADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQL 640
            ADG V  +    D  H FQR    + P F  +L
Sbjct: 2123 ADGMVETMNVRTDPTHTFQRNFTYNEPGFLIKL 2155


>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
          Length = 1356

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +2

Query: 596  QRYRQQHRPRFTTQLMLPTAPV 661
            Q+ +QQH+P  T   + P+AP+
Sbjct: 1320 QQQQQQHQPPSTQAQLRPSAPL 1341


>AY341195-1|AAR13759.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.4 bits (48), Expect = 8.2
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +2

Query: 524 EYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLML 646
           E  + E DG+++K  YT     GF+   ++   R    L L
Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEESSRRAEEALNL 265


>AY341194-1|AAR13758.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.4 bits (48), Expect = 8.2
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +2

Query: 524 EYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLML 646
           E  + E DG+++K  YT     GF+   ++   R    L L
Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEESSRRAEEALNL 265


>AY341193-1|AAR13757.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.4 bits (48), Expect = 8.2
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +2

Query: 524 EYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLML 646
           E  + E DG+++K  YT     GF+   ++   R    L L
Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEESSRRAEEALNL 265


>AY341192-1|AAR13756.1|  294|Anopheles gambiae laminin protein.
          Length = 294

 Score = 23.4 bits (48), Expect = 8.2
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +2

Query: 524 EYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLML 646
           E  + E DG+++K  YT     GF+   ++   R    L L
Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEESSRRAEEALNL 265


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
            precursor protein.
          Length = 1623

 Score = 23.4 bits (48), Expect = 8.2
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +2

Query: 524  EYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLML 646
            E  + E DG+++K  YT     GF+   ++   R    L L
Sbjct: 1364 EKAVAEGDGTLQKANYTYQTLAGFKNQVEESSRRAEEALNL 1404


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 557,827
Number of Sequences: 2352
Number of extensions: 8922
Number of successful extensions: 139
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 39
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 83576403
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).