SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30004
         (843 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    25   2.2  
AJ439060-17|CAD27768.1|  568|Anopheles gambiae putative chitin b...    24   5.0  
M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.              24   6.7  
CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein ...    23   8.8  

>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 25.4 bits (53), Expect = 2.2
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -2

Query: 119 LKSFNYINTVTVSVGGPCRSCR 54
           +K+ N +   T ++GGPC S R
Sbjct: 791 MKAINALAAFTPNIGGPCSSIR 812


>AJ439060-17|CAD27768.1|  568|Anopheles gambiae putative chitin
           binding protein protein.
          Length = 568

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 13/23 (56%), Positives = 13/23 (56%)
 Frame = +1

Query: 10  AXRSRTSGSPGAAGIRHERHGPP 78
           A R RT   PGAA  RH R  PP
Sbjct: 318 AGRLRTGPVPGAAE-RHRRRRPP 339


>M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.
          Length = 613

 Score = 23.8 bits (49), Expect = 6.7
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%)
 Frame = +1

Query: 325 MRAATCASEISIARPFFKIRLSCHRLI----NARD 417
           +R   C S + +A P  K  L C+R +    NARD
Sbjct: 529 LRLGFCISRVKMAPPTPKEHLRCYRCLEHGHNARD 563


>CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein
           protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 8.8
 Identities = 8/23 (34%), Positives = 12/23 (52%)
 Frame = -1

Query: 108 QLYKYGYCKCGRAVPLVPNSCSP 40
           Q+Y  GYC  G+ + + P    P
Sbjct: 104 QMYTRGYCPSGKIIYIEPKGKHP 126


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 751,773
Number of Sequences: 2352
Number of extensions: 12822
Number of successful extensions: 13
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 89305416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).