SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    44   8e-06
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    36   0.002
AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcript...    31   0.043
M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           29   0.17 
AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    29   0.17 
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    29   0.23 
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    26   1.2  
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    26   1.2  
Z69979-1|CAA93819.1|  127|Anopheles gambiae vacuolar ATPase prot...    24   5.0  
AY748834-1|AAV28182.1|  171|Anopheles gambiae cytochrome P450 pr...    24   6.6  
DQ383819-1|ABD38144.1|  377|Anopheles gambiae abdominal-B protein.     23   8.7  
AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript...    23   8.7  

>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 43.6 bits (98), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + G  + II  + +     +CRV     L      T+GV QGC+LSPLLF + ++D+
Sbjct: 632 LSKLGFGDGIISWLSSYLSNRSCRVKTGSYLSEEFFCTSGVPQGCVLSPLLFSLFINDV 690


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 1049

 Score = 35.5 bits (78), Expect = 0.002
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GIP+ ++  +++     T  V  D+ +   I  ++GV QG  + PLLFI+ ++D+
Sbjct: 703 LDKLGIPSPLVQWLKSYLIHRTYIVKIDKHMSKEIVSSSGVPQGSNIGPLLFILFINDV 761



 Score = 26.2 bits (55), Expect = 1.2
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = -3

Query: 132  LFDSIVKSVLLFGCETWR-VTKTLTNRLQVFVNKCLRSILRI 10
            +++ IV+SVL + C  W   T +   R++    K  R  LR+
Sbjct: 891  VYNCIVRSVLEYSCVVWSPTTASSIARIEAIQRKLTRYALRL 932


>AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcriptase
           protein.
          Length = 988

 Score = 31.1 bits (67), Expect = 0.043
 Identities = 17/64 (26%), Positives = 34/64 (53%)
 Frame = -1

Query: 716 GPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           G  L++   P     +++  + G T     D+ + +   ++AGV QG +L P L+ ++ D
Sbjct: 579 GQALQRENTPPYFQALLRNYFVGRTLHYDTDEKVVSRT-VSAGVPQGSVLGPTLWNVMYD 637

Query: 536 DIMR 525
           D++R
Sbjct: 638 DLLR 641


>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 29.1 bits (62), Expect = 0.17
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 13/170 (7%)
 Frame = -3

Query: 477  EDLDYADDIVLMTPTLD--QMQAKLEDLRISAE----KRGLRINTNKTVDMRVMS-KNTT 319
            E + YADD+VL+ P +D   ++A  E+   S      +  L+I   KT  + + S KN T
Sbjct: 721  EMVAYADDLVLLIPGIDVNAVKAAAEEAVASVSHWMAQHHLQIAPEKTECVLISSTKNPT 780

Query: 318  PLKLQDCGFEVS---TEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTR 148
             + ++    EV+   T  Y+   L  +        E+  R  + A A  + +   S   +
Sbjct: 781  QVTIRVGDVEVTSSRTMRYLGVTLHDHLSWLPHVREVTTRARKIADAVTRLLRNHS-GPK 839

Query: 147  RIKLTLFDSIVKSVLLFGCETW--RVTKTLTNRLQVFVNK-CLRSILRIF 7
              K  L  S+ +SV+ +    W   VTK    RL   V +   R + R F
Sbjct: 840  TSKARLLASVAESVIRYAAPIWHGEVTKRECRRLLERVQRVSARRVARTF 889


>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
           protein.
          Length = 1077

 Score = 29.1 bits (62), Expect = 0.17
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -1

Query: 680 IIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           ++G+++     S+ R++ +  L  PI +   V+QG  LS  LFI+ L  ++
Sbjct: 616 LVGLLRRFGDQSSSRILVNGSLSPPISIRRSVRQGDPLSMHLFILYLHPLI 666



 Score = 28.3 bits (60), Expect = 0.30
 Identities = 13/43 (30%), Positives = 23/43 (53%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
           YADDI ++T +  +++   E         G R+N +KT+ + V
Sbjct: 683 YADDISVVTTSSQKIELVREAFEAFGRVSGARLNVDKTIALDV 725


>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 28.7 bits (61), Expect = 0.23
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 6/63 (9%)
 Frame = -3

Query: 477 EDLDYADDIVLMTP--TLDQMQAKLEDLRISA----EKRGLRINTNKTVDMRVMSKNTTP 316
           E L YADD+VL+ P  T D ++A  E+  IS      +  L +   KT +M V+S    P
Sbjct: 654 EILGYADDLVLLVPGTTPDNVKAAAEEAIISVMEWMARHHLELAPAKT-EMVVISSTKAP 712

Query: 315 LKL 307
            ++
Sbjct: 713 TRI 715


>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion
            protein protein.
          Length = 1881

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = -3

Query: 456  DIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
            ++ L  P LD+ Q  + DLRI A  +G+    + TVD+ V
Sbjct: 1338 ELSLAAP-LDREQQMMYDLRIEAYDQGIPTPLSSTVDLIV 1376


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1154

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = -3

Query: 516 DNTRGIEWSENILEDLDYADDIVLMTP-TLDQMQAKLEDLRISAEKRGLR 370
           D   G+E      E + YADD+VL+ P T     A + +  +SA  R LR
Sbjct: 656 DGVLGVELPPGA-ELIGYADDLVLLAPGTTPAAAAVVAEEAVSAVDRWLR 704


>Z69979-1|CAA93819.1|  127|Anopheles gambiae vacuolar ATPase
           protein.
          Length = 127

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = -3

Query: 369 INTNKTVDMRVMSKNTTPLKLQDC 298
           IN N+  +  V+ KNT   +++DC
Sbjct: 32  INKNRHPNFMVVDKNTAVSEIEDC 55


>AY748834-1|AAV28182.1|  171|Anopheles gambiae cytochrome P450
           protein.
          Length = 171

 Score = 23.8 bits (49), Expect = 6.6
 Identities = 8/27 (29%), Positives = 15/27 (55%)
 Frame = +1

Query: 415 CLHLIQSWRHQHYVICIVKVFQDIFAP 495
           CLH + +  + HY+  ++K    +F P
Sbjct: 28  CLHTLSALNNLHYMELVIKESLRLFPP 54


>DQ383819-1|ABD38144.1|  377|Anopheles gambiae abdominal-B protein.
          Length = 377

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 12/41 (29%), Positives = 17/41 (41%)
 Frame = +1

Query: 4   PEYAEYRPQALIYKYLQPVRECLGHSPGFTSEKENTLDNGV 126
           P Y +Y P A I    +  R   G  P   S  E+   +G+
Sbjct: 191 PYYPKYEPDAYITASTERSRGVTGDQPSLQSSYESYNSSGL 231


>AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHD 624
           GIPN  + +    Y G  CRV  D
Sbjct: 457 GIPNAAVKVAIEKYPGVFCRVYQD 480


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 929,852
Number of Sequences: 2352
Number of extensions: 20183
Number of successful extensions: 40
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 88065063
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).