BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0119 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 25 2.7 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 25 2.7 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 25 2.7 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 3.6 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 24 3.6 AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 pr... 23 6.3 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.3 AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding pr... 23 8.3 AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding pr... 23 8.3 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 221 CEDRRVVYRCXHCQFMDMLFPGSVPMKRI--KFKTNLEH 331 C+ R YRC H Q +D P +R F+ EH Sbjct: 119 CDYERRTYRCLHSQRLDRPAPHDEACERAYESFRCYYEH 157 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 221 CEDRRVVYRCXHCQFMDMLFPGSVPMKRI--KFKTNLEH 331 C+ R YRC H Q +D P +R F+ EH Sbjct: 103 CDYERRTYRCLHSQRLDRPAPHDEACERAYESFRCYYEH 141 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 221 CEDRRVVYRCXHCQFMDMLFPGSVPMKRI--KFKTNLEH 331 C+ R YRC H Q +D P +R F+ EH Sbjct: 119 CDYERRTYRCLHSQRLDRPAPHDEACERAYESFRCYYEH 157 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 24.2 bits (50), Expect = 3.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 524 WQPFSSPMRHM 492 W+PFS P RH+ Sbjct: 460 WKPFSEPTRHL 470 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 24.2 bits (50), Expect = 3.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 249 HLYTTLRSSQSLTGDNHSPTLAY 181 H+YTT S+ T +HSP Y Sbjct: 357 HIYTTPSSNSLSTQHSHSPVNGY 379 >AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 107 LDEKILDREFIFILNKFAV 51 LDE ++ + FI +LN FA+ Sbjct: 131 LDEYVIPKGFILLLNVFAL 149 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 295 WYTAREQHVHELAMAAPVHN 236 W TARE+ V +A PV N Sbjct: 20 WQTAREREVDLFIVADPVKN 39 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 8.3 Identities = 19/82 (23%), Positives = 35/82 (42%) Frame = +3 Query: 117 IVKMAVNVYSTNVTSENLSRHDMLAWVNDCLQSNFAKIEELCTGAAIASSWTCCSLAVYQ 296 I+ +A ++ T E L L ++ CL++ ++ + ++ T L Sbjct: 187 ILGLAGPLHGAGCTPERLCWE--LHYLERCLRARIETASDITSVLRFSTKPTELILECIP 244 Query: 297 *KESNLRQIWNMNIYRTLKYYK 362 K SNL Q+ M I R + + K Sbjct: 245 PKPSNLTQLLRMLIQRQIAFLK 266 >AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding protein AgamOBP4 protein. Length = 150 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 468 KNFLNHCKNSKLSWKRP 418 K L HCK+++ S+K P Sbjct: 112 KEALTHCKDTQTSYKDP 128 >AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding protein protein. Length = 150 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 468 KNFLNHCKNSKLSWKRP 418 K L HCK+++ S+K P Sbjct: 112 KEALTHCKDTQTSYKDP 128 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,098 Number of Sequences: 2352 Number of extensions: 14770 Number of successful extensions: 53 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -