BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0108 (498 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 27 0.35 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 1.1 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 4.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 27.1 bits (57), Expect = 0.35 Identities = 21/67 (31%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 402 CACDRNDSCMAMRGDHIAPSEREVPCRXTFVRPSCPGLLXRHDXXKPSRSESSTFPCVP- 226 C C N +CM M GD + E C + P C L P+ S C P Sbjct: 776 CPCPNNGACMQMAGDTVICLE----CPVGYFGPRCE-LCSDGYYGDPTGVYGSVRMCQPC 830 Query: 225 -ISGNVD 208 +GNVD Sbjct: 831 DCNGNVD 837 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 97 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 219 PPP+ + + + L + T E V ++C E G I+ P Sbjct: 756 PPPKPPTVTMMDMQQLDTQPTLEFKELVSQKCAERGIIFAP 796 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 81 NELRKTSATNRWHGLV 128 N L T+ATNR+ GLV Sbjct: 426 NGLHSTTATNRFSGLV 441 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 431,776 Number of Sequences: 2352 Number of extensions: 8046 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -