SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.   120   4e-29
AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.   120   4e-29
AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.   120   4e-29
AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.   120   4e-29
AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical prote...    24   5.3  
AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical prote...    24   5.3  
AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein ...    23   7.0  
AY462096-1|AAS21248.1|  603|Anopheles gambiae transposase protein.     23   7.0  
CR954256-8|CAJ14149.1|  247|Anopheles gambiae putative signal pe...    23   9.2  

>AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score =  120 bits (289), Expect = 4e-29
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 178
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q
Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188


>AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score =  120 bits (289), Expect = 4e-29
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 178
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q
Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188


>AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score =  120 bits (289), Expect = 4e-29
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 178
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q
Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188


>AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score =  120 bits (289), Expect = 4e-29
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 178
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q
Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188


>AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 10/34 (29%), Positives = 14/34 (41%)
 Frame = +2

Query: 386 KWLRPSLVTRRPYRPYSRGCLSSSWLCLGGKPSC 487
           +W R     RR   PY  G +  +W  L    +C
Sbjct: 117 RWTRSGATGRRQPHPYRAGRVGQTWQRLLSVTTC 150


>AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 10/34 (29%), Positives = 14/34 (41%)
 Frame = +2

Query: 386 KWLRPSLVTRRPYRPYSRGCLSSSWLCLGGKPSC 487
           +W R     RR   PY  G +  +W  L    +C
Sbjct: 117 RWTRSGATGRRQPHPYRAGRVGQTWQRLLSVTTC 150


>AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein
           protein.
          Length = 680

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 10/32 (31%), Positives = 13/32 (40%)
 Frame = -2

Query: 574 YCWYSDIKSFMLDSASVNSISSYPHQCTSARR 479
           YC Y+  K F+L           PH+C    R
Sbjct: 131 YCNYTSNKLFLLSRHLKTHSEDRPHKCVVCER 162


>AY462096-1|AAS21248.1|  603|Anopheles gambiae transposase protein.
          Length = 603

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 8/19 (42%), Positives = 14/19 (73%)
 Frame = -3

Query: 426 LYGRRVTNEGRSHFKTPRR 370
           L+G  + N+G  ++KTPR+
Sbjct: 500 LFGDLLKNKGAQNYKTPRQ 518


>CR954256-8|CAJ14149.1|  247|Anopheles gambiae putative signal
           peptidase protein.
          Length = 247

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 2/31 (6%)
 Frame = -3

Query: 384 KTPRRYVTHGNLAVIGYPLDKI--RAVFVLN 298
           K+P + V H    +IG P D+I  RA F LN
Sbjct: 71  KSPTKPVQHVCKRIIGMPGDRIMTRASFNLN 101


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 698,038
Number of Sequences: 2352
Number of extensions: 13899
Number of successful extensions: 30
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71086350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).