SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY390608-1|AAR27305.1|  242|Anopheles gambiae SP22D protein.           24   2.5  
AY390607-1|AAR27304.1|  242|Anopheles gambiae SP22D protein.           24   2.5  
AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p...    24   2.5  
AY750997-1|AAV31069.1|  153|Anopheles gambiae peritrophin-1 prot...    24   3.3  
AY344823-1|AAR02434.1|  153|Anopheles gambiae peritrophin A prot...    24   3.3  
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    23   4.4  
AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona...    23   5.8  
M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ...    23   7.6  
M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles ...    23   7.6  

>AY390608-1|AAR27305.1|  242|Anopheles gambiae SP22D protein.
          Length = 242

 Score = 24.2 bits (50), Expect = 2.5
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 7/77 (9%)
 Frame = -3

Query: 437 ELQY*AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEERRS---GTETA 267
           + QY    R+H     P+Q+   +  +  G +  +      L PY +E +R+   G   A
Sbjct: 4   QYQYAQPQRQHPSLVGPQQQQHQQQQQQHGPSGPQYQPGVPLAPYPTETQRAPAYGRSQA 63

Query: 266 *LQTPSQF----SFGYG 228
             Q P+       FGYG
Sbjct: 64  YTQQPAPVPLAPRFGYG 80


>AY390607-1|AAR27304.1|  242|Anopheles gambiae SP22D protein.
          Length = 242

 Score = 24.2 bits (50), Expect = 2.5
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 7/77 (9%)
 Frame = -3

Query: 437 ELQY*AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEERRS---GTETA 267
           + QY    R+H     P+Q+   +  +  G +  +      L PY +E +R+   G   A
Sbjct: 4   QYQYAQPQRQHPSLVGPQQQQHQQQQQQHGPSGPQYQPGVPLAPYPTETQRAPAYGRSQA 63

Query: 266 *LQTPSQF----SFGYG 228
             Q P+       FGYG
Sbjct: 64  YTQQPAPVPLAPRFGYG 80


>AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton
            exchanger 3 protein.
          Length = 1221

 Score = 24.2 bits (50), Expect = 2.5
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -3

Query: 377  TASRALEDRGATYAERSSTRALRPYSSEERRSGTETA 267
            TA  +L++RGA   ++  +R  R +   E+R  T TA
Sbjct: 912  TAKSSLDERGAAKEDKRFSRESR-FLESEQRVATPTA 947


>AY750997-1|AAV31069.1|  153|Anopheles gambiae peritrophin-1
           protein.
          Length = 153

 Score = 23.8 bits (49), Expect = 3.3
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -1

Query: 415 VADISQHPNHDSEQPPELL 359
           +AD+   P  D EQPP LL
Sbjct: 16  LADVRCPPQDDPEQPPVLL 34


>AY344823-1|AAR02434.1|  153|Anopheles gambiae peritrophin A
           protein.
          Length = 153

 Score = 23.8 bits (49), Expect = 3.3
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -1

Query: 415 VADISQHPNHDSEQPPELL 359
           +AD+   P  D EQPP LL
Sbjct: 16  LADVRCPPQDDPEQPPVLL 34


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 23.4 bits (48), Expect = 4.4
 Identities = 20/84 (23%), Positives = 34/84 (40%), Gaps = 7/84 (8%)
 Frame = -3

Query: 458 EKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEERRS- 282
           +++    + QY    R+H     P+ +   +  +  G +  +      L PY +E +RS 
Sbjct: 68  QQYIQTDQYQYAQPQRQHPSLVGPQLQQQQQQHQQHGPSGPQYQPGVPLAPYPTETQRSP 127

Query: 281 --GTETA*LQTPSQF----SFGYG 228
             G   A  Q P+       FGYG
Sbjct: 128 AYGRSQAYTQQPAPVPLAPRFGYG 151


>AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate
           anion exchanger protein.
          Length = 1102

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -3

Query: 419 ASRRHFPTSEPRQRTASRALEDRGATYAE 333
           +SRRH      +   ASR   D+G+T +E
Sbjct: 45  SSRRHSQRRRHKHHQASRENGDKGSTGSE 73


>M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 1222

 Score = 22.6 bits (46), Expect = 7.6
 Identities = 15/52 (28%), Positives = 20/52 (38%)
 Frame = +1

Query: 262 SHAVSVPERRSSDEYGRRARVELRSAYVAPRSSRALEAVRCRGSDVGKCRRL 417
           S  V+   R   +  G R       AYVA    R    V    + V +CRR+
Sbjct: 815 SRVVAAVTRLMQNHSGPRTAKSRLLAYVAESVLRYAAPVWAEATQVRECRRM 866


>M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 574

 Score = 22.6 bits (46), Expect = 7.6
 Identities = 12/29 (41%), Positives = 14/29 (48%)
 Frame = -1

Query: 400 QHPNHDSEQPPELLKTAVPRTRSEAQRAL 314
           Q   H+ EQP      AV   RSEA  A+
Sbjct: 224 QRNQHEQEQPRASTSRAVMPPRSEALTAV 252


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 482,119
Number of Sequences: 2352
Number of extensions: 8083
Number of successful extensions: 20
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 44400195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).