SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF525673-1|AAM82611.1|   60|Anopheles gambiae cecropin CecB prot...    42   1e-05
AY146721-1|AAO12081.1|  144|Anopheles gambiae odorant-binding pr...    25   1.1  
AY146723-1|AAO12083.1|  155|Anopheles gambiae odorant-binding pr...    25   1.5  
AY035716-1|AAK61362.1|  136|Anopheles gambiae histone 3A protein.      24   2.6  
AF437884-1|AAL84179.1|  144|Anopheles gambiae odorant binding pr...    24   2.6  
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    23   4.6  
AY062208-1|AAL58569.1|  503|Anopheles gambiae cytochrome P450 CY...    23   6.1  
AJ439353-9|CAD27931.1|  391|Anopheles gambiae transcription fact...    23   6.1  

>AF525673-1|AAM82611.1|   60|Anopheles gambiae cecropin CecB
           protein.
          Length = 60

 Score = 41.5 bits (93), Expect = 1e-05
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +1

Query: 58  MNFAKILSFV-FALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAK 234
           MNF K+   V  A+++ + +      PRWK  K++EK+GRN+     KA P   V+   K
Sbjct: 1   MNFTKLFILVAIAVLVVVGVQPVDGAPRWKFGKRLEKLGRNVFRAAKKALP---VIAGYK 57

Query: 235 AIG 243
           A+G
Sbjct: 58  ALG 60


>AY146721-1|AAO12081.1|  144|Anopheles gambiae odorant-binding
           protein AgamOBP1 protein.
          Length = 144

 Score = 25.0 bits (52), Expect = 1.1
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +1

Query: 70  KILSFVFALVLALSMTSAAPEPR 138
           K+++FVFA +L  SMT     PR
Sbjct: 2   KLVTFVFAALLCCSMTLGDTTPR 24


>AY146723-1|AAO12083.1|  155|Anopheles gambiae odorant-binding
           protein AgamOBP17 protein.
          Length = 155

 Score = 24.6 bits (51), Expect = 1.5
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +1

Query: 70  KILSFVFALVLALSMTSAAPEPR 138
           K+++FVFA+++  SMT     PR
Sbjct: 2   KLVTFVFAVLVCCSMTLGDTTPR 24


>AY035716-1|AAK61362.1|  136|Anopheles gambiae histone 3A protein.
          Length = 136

 Score = 23.8 bits (49), Expect = 2.6
 Identities = 18/72 (25%), Positives = 31/72 (43%)
 Frame = -1

Query: 225 TEDLDRRARFDDAVTDVPAHFFNFLEDLPPGLGSSTGHAQSQHQSEDEG*DLCEIHCKFI 46
           TE L R+  F   V ++   F   L      +G+    +++      E  +LC IH K +
Sbjct: 59  TELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRV 118

Query: 45  *IQTRTLRHKRR 10
            I  + ++  RR
Sbjct: 119 TIMPKDIQLARR 130


>AF437884-1|AAL84179.1|  144|Anopheles gambiae odorant binding
           protein protein.
          Length = 144

 Score = 23.8 bits (49), Expect = 2.6
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +1

Query: 70  KILSFVFALVLALSMTSAAPEPR 138
           K+++FVFA ++  SMT     PR
Sbjct: 2   KLVTFVFAALVCCSMTLGDTTPR 24


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = -3

Query: 223 RGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRR 83
           R PRS G    CR   +    + S R ++W R +  S  K  P RRR
Sbjct: 260 RSPRSGGRWPSCRSPPARRRSR-STRPTSWPRSRPTSKPKRLPRRRR 305


>AY062208-1|AAL58569.1|  503|Anopheles gambiae cytochrome P450
           CYP6M1 protein.
          Length = 503

 Score = 22.6 bits (46), Expect = 6.1
 Identities = 10/31 (32%), Positives = 15/31 (48%)
 Frame = -2

Query: 248 HFPMALAEPRTSIAGPALTMPSRMFLPIFSI 156
           HF M   + R       +   + +F+PIFSI
Sbjct: 372 HFRMTAQDYRVPDTDSVIEAGTMLFIPIFSI 402


>AJ439353-9|CAD27931.1|  391|Anopheles gambiae transcription factor
           protein.
          Length = 391

 Score = 22.6 bits (46), Expect = 6.1
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -1

Query: 225 TEDLDRRARFDDAVTDVPAHFFNFLEDLP 139
           T D  R+ R   AVT +PA +++ +  LP
Sbjct: 287 TPDAARKHRQICAVTRLPARYYDPITQLP 315


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 411,089
Number of Sequences: 2352
Number of extensions: 7552
Number of successful extensions: 26
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 35292513
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).