SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0022
         (598 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript...    25   1.4  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    25   2.5  
AJ515150-1|CAD56157.2|  737|Anopheles gambiae acetylcholinestera...    23   5.7  
AJ515149-1|CAD56156.1|  737|Anopheles gambiae acetylcholinestera...    23   5.7  
AJ488492-1|CAD32684.2|  623|Anopheles gambiae acetylcholinestera...    23   5.7  
AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    23   9.9  

>AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 25.4 bits (53), Expect = 1.4
 Identities = 14/40 (35%), Positives = 19/40 (47%)
 Frame = -2

Query: 411 RTQIIFRTGRDRSIASLYFPANENDYTSLVQTLLMHLRGS 292
           R +   + G+    A L   A EN+     Q +L HLRGS
Sbjct: 353 RLEKAIKVGKRAEFAKLIDIAEENELGVGYQVVLSHLRGS 392


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 11/28 (39%), Positives = 12/28 (42%)
 Frame = +3

Query: 75  RTVLWYVVQTTVKKIHXIQPTTCCPXNH 158
           RTVLW  V   VK +       CC   H
Sbjct: 8   RTVLWVTVIVLVKVMVKSDAQVCCMVEH 35


>AJ515150-1|CAD56157.2|  737|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 737

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -1

Query: 337 LHKLSANSFDAFERLLTHSG 278
           LH LSA S D F+R +  SG
Sbjct: 368 LHLLSALSRDLFQRAILQSG 387


>AJ515149-1|CAD56156.1|  737|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 737

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -1

Query: 337 LHKLSANSFDAFERLLTHSG 278
           LH LSA S D F+R +  SG
Sbjct: 368 LHLLSALSRDLFQRAILQSG 387


>AJ488492-1|CAD32684.2|  623|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 623

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -1

Query: 337 LHKLSANSFDAFERLLTHSG 278
           LH LSA S D F+R +  SG
Sbjct: 254 LHLLSALSRDLFQRAILQSG 273


>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = -2

Query: 390 TGRDRSIASLYFPANENDYTSLVQTLLMHLRGS 292
           TG+ +         N N Y S  Q +  HLRGS
Sbjct: 358 TGKGQLFQQQIDEVNANVYGSGYQVVTSHLRGS 390


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 598,972
Number of Sequences: 2352
Number of extensions: 10749
Number of successful extensions: 19
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).