SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF364131-1|AAL35507.1|  378|Anopheles gambiae putative odorant r...    24   3.2  
AY146758-1|AAO12073.1|  289|Anopheles gambiae odorant-binding pr...    23   7.5  
AJ618930-1|CAF02010.2|  273|Anopheles gambiae odorant-binding pr...    23   7.5  
AF393485-1|AAL60410.1|  289|Anopheles gambiae odorant binding pr...    23   7.5  

>AF364131-1|AAL35507.1|  378|Anopheles gambiae putative odorant
           receptor Or2 protein.
          Length = 378

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = -3

Query: 509 IIVILLTFS*CCFHIVIKHYYHFC 438
           ++ + LTF  CC +I    +Y  C
Sbjct: 168 VLQVYLTFPACCMYIPFTSFYATC 191


>AY146758-1|AAO12073.1|  289|Anopheles gambiae odorant-binding
           protein AgamOBP30 protein.
          Length = 289

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 15/41 (36%), Positives = 18/41 (43%)
 Frame = +2

Query: 347 CSRPFFRIRHVQTIYIQSNNVAFHQIIRLNYKNGSNVLLQC 469
           C R +   R     Y   N V   Q +RLN     +VLLQC
Sbjct: 144 CERAYESFRCYYEHY--GNLVVTPQFVRLNALQQLDVLLQC 182


>AJ618930-1|CAF02010.2|  273|Anopheles gambiae odorant-binding
           protein OBPjj83c protein.
          Length = 273

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 15/41 (36%), Positives = 18/41 (43%)
 Frame = +2

Query: 347 CSRPFFRIRHVQTIYIQSNNVAFHQIIRLNYKNGSNVLLQC 469
           C R +   R     Y   N V   Q +RLN     +VLLQC
Sbjct: 128 CERAYESFRCYYEHY--GNLVVTPQFVRLNALQQLDVLLQC 166


>AF393485-1|AAL60410.1|  289|Anopheles gambiae odorant binding
           protein 1 protein.
          Length = 289

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 15/41 (36%), Positives = 18/41 (43%)
 Frame = +2

Query: 347 CSRPFFRIRHVQTIYIQSNNVAFHQIIRLNYKNGSNVLLQC 469
           C R +   R     Y   N V   Q +RLN     +VLLQC
Sbjct: 144 CERAYESFRCYYEHY--GNLVVTPQFVRLNALQQLDVLLQC 182


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 542,604
Number of Sequences: 2352
Number of extensions: 10085
Number of successful extensions: 11
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).