SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.    56   9e-10
AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.    56   9e-10
AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.    56   9e-10
AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.    56   9e-10
U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles ...    27   0.61 
AY176048-1|AAO19579.1|  521|Anopheles gambiae cytochrome P450 CY...    25   2.5  
AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P...    24   3.2  
AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.    24   4.3  
AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript...    24   4.3  
AJ441131-2|CAD29631.1|  208|Anopheles gambiae hypothetical prote...    23   5.7  
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    23   5.7  
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    23   5.7  
AF117749-1|AAD38335.1|  372|Anopheles gambiae serine protease 14...    23   5.7  
AJ439398-1|CAD28124.1|  208|Anopheles gambiae hypothetical prote...    23   7.5  

>AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 56.0 bits (129), Expect = 9e-10
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +2

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           HYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGF 29


>AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 56.0 bits (129), Expect = 9e-10
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +2

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           HYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGF 29


>AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 56.0 bits (129), Expect = 9e-10
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +2

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           HYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGF 29


>AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 56.0 bits (129), Expect = 9e-10
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +2

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           HYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGF 29


>U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles
           gambiae putativetubulin alpha chain mRNA, complete cds.
           ).
          Length = 91

 Score = 26.6 bits (56), Expect = 0.61
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWE 185
           MRE + +  GQ G QIG   W+
Sbjct: 1   MRECISVHVGQAGVQIGNPCWD 22


>AY176048-1|AAO19579.1|  521|Anopheles gambiae cytochrome P450
           CYP12F4 protein.
          Length = 521

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +1

Query: 328 WNHGLRPFRAVWANLPTGQLRLR 396
           WN+G   +RA   N+P   L+ +
Sbjct: 493 WNYGELKYRATLVNIPANDLKFQ 515


>AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P450
           reductase protein.
          Length = 679

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 174 KFWEVISDEHGIDATG 221
           KFW  + D  GI++TG
Sbjct: 225 KFWPTVCDYFGIESTG 240


>AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.
          Length = 1187

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -2

Query: 396 PKTKLSGRKICPNGPERTESMVPGSRSTITA 304
           P  K+SGRKI P+     E +V G  +  TA
Sbjct: 575 PLNKISGRKIDPSVARFAEELV-GKENVTTA 604


>AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1009

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%)
 Frame = -1

Query: 403 RLSEDEVVR-SEDLP--KRPGTDGVHGSRLKV 317
           R++ DE++  +  LP  K PG DG+    LKV
Sbjct: 396 RITNDEILAVARRLPNKKAPGPDGIPNEALKV 427


>AJ441131-2|CAD29631.1|  208|Anopheles gambiae hypothetical protein
           protein.
          Length = 208

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +2

Query: 296 VPRAVMVDLEPGTMDSVRSGPFGQIF----RPDNFVFGQSGAGNNWAKGHYTEGAEL 454
           +P   +  L  G+ +S     FG  F    RP N+ + ++   NN  + H T  A L
Sbjct: 106 LPSLAITGLSIGSSNSSFLRQFGPQFTGTKRPQNWFYSRNNNNNNNNEHHNTYNARL 162


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = -1

Query: 340 VHGSRLKVHHHSSRD 296
           +HG+  +VHHH ++D
Sbjct: 50  MHGAYSQVHHHRAQD 64


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = -1

Query: 340 VHGSRLKVHHHSSRD 296
           +HG+  +VHHH ++D
Sbjct: 50  MHGAYSQVHHHRAQD 64


>AF117749-1|AAD38335.1|  372|Anopheles gambiae serine protease 14D2
           protein.
          Length = 372

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +2

Query: 392 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 478
           FG    G +   G YT  +E +D VLD +
Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371


>AJ439398-1|CAD28124.1|  208|Anopheles gambiae hypothetical protein
           protein.
          Length = 208

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +2

Query: 296 VPRAVMVDLEPGTMDSVRSGPFGQIF----RPDNFVFGQSGAGNNWAKGHYTEGAEL 454
           +P   +  L  G+ +S     FG  F    RP N+ + ++   NN  + H T  A L
Sbjct: 106 LPSLAITGLSIGSSNSRFLRQFGPQFTGTNRPQNWFYSRNNNNNNNNEHHNTYNARL 162


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 640,285
Number of Sequences: 2352
Number of extensions: 13545
Number of successful extensions: 31
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).