SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY843205-1|AAX14774.1|  478|Anopheles gambiae odorant receptor O...    25   1.9  
AY363726-1|AAR14939.1|  331|Anopheles gambiae seven transmembran...    25   1.9  
AY363725-1|AAR14938.1|  478|Anopheles gambiae seven transmembran...    25   1.9  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            25   2.5  

>AY843205-1|AAX14774.1|  478|Anopheles gambiae odorant receptor
           Or83b protein.
          Length = 478

 Score = 25.0 bits (52), Expect = 1.9
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = -3

Query: 86  NLLIKETNSLL*IMYICHYY 27
           N LI+E++S++   Y CH+Y
Sbjct: 405 NRLIEESSSVMEAAYSCHWY 424


>AY363726-1|AAR14939.1|  331|Anopheles gambiae seven transmembrane G
           protein-coupledreceptor protein.
          Length = 331

 Score = 25.0 bits (52), Expect = 1.9
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = -3

Query: 86  NLLIKETNSLL*IMYICHYY 27
           N LI+E++S++   Y CH+Y
Sbjct: 258 NRLIEESSSVMKAAYSCHWY 277


>AY363725-1|AAR14938.1|  478|Anopheles gambiae seven transmembrane G
           protein-coupledreceptor protein.
          Length = 478

 Score = 25.0 bits (52), Expect = 1.9
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = -3

Query: 86  NLLIKETNSLL*IMYICHYY 27
           N LI+E++S++   Y CH+Y
Sbjct: 405 NRLIEESSSVMEAAYSCHWY 424


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = +3

Query: 282  YDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNV 380
            Y    +E+K   L Y  F   ++ ID  K KN+
Sbjct: 2284 YFHGLEELKLAPLTYHTFHKEIKGIDEAKSKNI 2316


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 587,744
Number of Sequences: 2352
Number of extensions: 10836
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).