SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0008
         (698 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger transc...    26   1.3  
AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsi...    25   2.3  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    24   4.0  
AY146729-1|AAO12089.1|  156|Anopheles gambiae odorant-binding pr...    24   5.3  
AF437888-1|AAL84183.1|  154|Anopheles gambiae odorant binding pr...    24   5.3  
AJ697719-1|CAG26912.1|  174|Anopheles gambiae putative odorant-b...    23   7.0  
X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.     23   9.2  

>AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger
           transcription factor pannier protein.
          Length = 537

 Score = 25.8 bits (54), Expect = 1.3
 Identities = 15/66 (22%), Positives = 25/66 (37%)
 Frame = -2

Query: 361 TTQRNRAQHVGNSTFSSSMYSWHSSAFSGIFGFRHPXXXXXXXXXXXXICSGGTCSDPTT 182
           TT    + H+  +  S+S+ + HS +    +G  HP               GG  + P+ 
Sbjct: 349 TTAGLNSSHIYTTPSSNSLSTQHSHSPVNGYGNNHPTGGSNLPGNNNGGAGGGGSNTPSN 408

Query: 181 LATAGN 164
               GN
Sbjct: 409 HGALGN 414


>AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsive
           serine proteaselike protein protein.
          Length = 600

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = +1

Query: 67  LGALFMLCCLVLPALSAEDVSYQACVDKYSRKGY 168
           L AL   C LV  A  A+ +  + CV   +R GY
Sbjct: 6   LVALVAGCLLVAVAAQADYIQQEQCVTASNRAGY 39


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = +3

Query: 396 GQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEPR 512
           GQP  + P  P  G + + +P    +SG   + + G PR
Sbjct: 261 GQPPPIRPPNPMGGPRPQISPQNSNLSGGMPSGMVGPPR 299


>AY146729-1|AAO12089.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP5 protein.
          Length = 156

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +3

Query: 207 PLQMRDQRREILHSC 251
           P  MRD+ +E +HSC
Sbjct: 110 PPDMRDKAKEAIHSC 124


>AF437888-1|AAL84183.1|  154|Anopheles gambiae odorant binding
           protein protein.
          Length = 154

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +3

Query: 207 PLQMRDQRREILHSC 251
           P  MRD+ +E +HSC
Sbjct: 108 PPDMRDKAKEAIHSC 122


>AJ697719-1|CAG26912.1|  174|Anopheles gambiae putative
           odorant-binding protein OBPjj9 protein.
          Length = 174

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = +1

Query: 391 PEGSLANCSPINHGRANK 444
           PEG++A CS +N+  A +
Sbjct: 29  PEGTVAGCSMLNNDNAEQ 46


>X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.
          Length = 696

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = -2

Query: 364 STTQRNRAQHVGNSTFSSSMYSWHSSA 284
           STT  NR +   N   S   Y  HS++
Sbjct: 611 STTDLNRLEQTANMQTSGGNYQQHSAS 637


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 795,249
Number of Sequences: 2352
Number of extensions: 17929
Number of successful extensions: 31
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71086350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).